Recombinant Rat G-protein coupled receptor 182 (Gpr182)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request to the best of our ability.
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
Gpr182; Admr; G-protein coupled receptor 182; G10D; NOW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSVIPSSRPVSTLAPDNDFREIHNWTELLHLFNQTFSDCHMELNENTKQVVLFVFYLAIF
VVGLVENVLVICVNCRRSGRVGMLNLYILNMAVADLGIILSLPVWMLEVMLEYTWLWGSF
SCRFIHYFYLANMYSSIFFLTCLSIDRYVTLTNTSPSWQRHQHRIRRAVCAGVWVLSAII
PLPEVVHIQLLDGSEPMCLFLAPFETYSAWALAVALSATILGFLLPFPLIAVFNILSACR
LRRQGQTESRRHCLLMWAYIVVFVICWLPYHVTMLLLTLHTTHIFLHCNLVNFLYFFYEI
IDCFSMLHCVANPILYNFLSPSFRGRLLSLVVRYLPKEQARAAGGRASSSSSTQHSIIIT
KEGSLPLQRICTPTPSETCRPPLCLRTPHLHSAIP
Uniprot No.
Target Background
Function
Orphan receptor.
Database Links
STRING: 10116.ENSRNOP00000054500
UniGene: Rn.87119
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a wide variety of peripheral tissues in the adult rat with prominent expression in lung, testis, adrenal and liver.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
