Recombinant Rat G-protein coupled receptor 26 (Gpr26)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Gpr26 is an orphan receptor with no confirmed endogenous ligand but shares structural homology with serotonin and gastrin-releasing hormone receptors . Key findings include:

Metabolic Regulation

  • Knockout mice exhibited hyperphagia, adiposity, and insulin resistance, suggesting Gpr26 suppresses appetite and modulates energy homeostasis .

  • Hypersensitivity to rimonabant (a cannabinoid receptor antagonist) in Gpr26-deficient mice implies cross-talk with endocannabinoid pathways .

Neuroendocrine Roles

  • Expressed in hypothalamic neurons regulating AMP-activated protein kinase (AMPK), a key energy sensor .

  • Modulates ERK1/2 and NF-κB pathways in monocytes under hyperglycemic conditions, influencing inflammation and apoptosis .

Signaling Pathways

PathwayAssociated Proteins/Effects
Gαi/o-coupled activityReduces cAMP levels; linked to appetite suppression
MAPK/ERK activationPromotes monocyte adhesion and ROS generation
Autophagy regulationKnockdown inhibits autophagic flux in THP-1 cells

Research Applications

Recombinant Gpr26 is used to:

  1. Investigate GPCR activation mechanisms via site-directed mutagenesis (e.g., TM6 helix rearrangements) .

  2. Study metabolic disorders using in vitro models of hyperglycemia and obesity .

  3. Screen for synthetic ligands or antibodies targeting its extracellular loops .

Production and Purification

ParameterSpecification
Expression SystemE. coli (high-yield, cost-effective)
TagN-terminal His-tag for affinity chromatography
Purity>90% (SDS-PAGE verified)
StorageLyophilized at -80°C in Tris/PBS buffer with 6% trehalose

Clinical Implications

  • Obesity Therapy: Gpr26 activation could bypass side effects of rimonabant (e.g., depression) by targeting distinct neural circuits .

  • Diabetes: Downregulation in diabetic PBMCs correlates with HbA1c levels, suggesting diagnostic or therapeutic potential .

Challenges and Future Directions

  • Ligand Identification: High-throughput screening efforts are ongoing to deorphanize Gpr26 .

  • Structural Biology: No resolved 3D structures exist; cryo-EM studies are needed to map ligand-binding pockets .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a 6-month shelf life at -20°C/-80°C. Lyophilized form has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development if possible.
Synonyms
Gpr26; G-protein coupled receptor 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MNSWDAGLAGLLVGTIGVSLLSNGLVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNM PLTLAGVVAQRQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRL RDAAFMVAYTWLHALTFPATALALSWLGFHQLYASCTLCSRRPDERLRFAVFTSAFHALS FLLSFIVLCFTYLKVLKVARFHCKRIDVITMQTLVLLVDIHPSVRERCLEEQKRRRQRAT KKISTFIGTFLVCFAPYVITRLVELFSTAPIDSHWGVLSKCLAYSKAASDPFVYSLLRHQ YRRSCKELLNRIFNRRSIHSVGLTGDSHSQNILPVSE
Uniprot No.

Target Background

Function
Orphan receptor. Exhibits a significant level of constitutive activity. Its effects are mediated by G(s)-alpha protein, stimulating adenylate cyclase, leading to an elevation of intracellular cAMP.
Gene References Into Functions
  1. We conclude that the orphan receptors GPR26, GPR39v1, and GPR39v2 are expressed in different tissues, and their expression profiles are dependent on the etiology of the Metabolic syndrome. PMID: 28270014
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in extracts of several brain regions including striatum, pons, cerebellum and cortex. Not detected in numerous peripheral tissue extracts, except in testis. In the brain, detected in cortical structures including the anterior cingulate area, post

Q&A

What is Gpr26 and what are its key characteristics?

Gpr26 is a brain-specific orphan G-protein coupled receptor without known endogenous ligands . It was first described in 2000 and belongs to the GPCR family . The amino acid sequence of Gpr26 is highly conserved across species, with approximately 95% sequence identity between human and mouse orthologs, indicating strong phylogenetic conservation of protein structure and associated functional properties . Gpr26 is exclusively expressed in brain tissue, with particularly high expression in regions associated with appetite control .

Gpr26 is coupled to Gs, meaning that activation of Gpr26 leads to increased cAMP levels in target cells . It exhibits the highest sequence homology with the serotonin receptor 5-HT5A and gastrin releasing hormone BB2 receptor, suggesting a potential role in regulating energy metabolism . The human GPR26 gene has been mapped to an obesity locus on chromosome 10 q26 .

What expression systems are most effective for producing recombinant rat Gpr26?

For recombinant Gpr26 expression, researchers should consider that non-mammalian expression systems often yield higher protein quantities than mammalian systems, though functional expression may vary . When designing expression systems for Gpr26, it's essential to optimize the gene construct as a first step in the expression process .

For mammalian expression of recombinant rat Gpr26, codon optimization is highly recommended to enhance protein production . Additionally, incorporating Kozak sequences (GCCACCATGG) and signal peptide sequences at the 5' end of the Gpr26 construct can significantly enhance protein expression and cell surface delivery .

The optimized construct can then be ligated into a plasmid vector for either transient transfection or stable cell line creation . Since Gpr26 is a brain-specific GPCR, neuronal cell lines may provide a more physiologically relevant environment for functional expression.

How can I verify successful expression and functionality of recombinant rat Gpr26?

Verifying both expression and functionality of recombinant Gpr26 requires multiple complementary approaches:

  • Transcript verification: RT-PCR can confirm the presence of Gpr26 mRNA in your expression system, as demonstrated in Gpr26 knockout verification studies .

  • Protein expression confirmation: Immunohistochemistry or western blotting using anti-Gpr26 antibodies can verify protein expression .

  • Functional assays: Since Gpr26 is Gs-coupled, cAMP assays are essential to confirm functional activity. Higher levels of expression do not necessarily correlate with functional expression, so a robust assay for signaling is crucial in any optimization process .

  • Ligand binding studies: Though Gpr26 is an orphan receptor, binding assays using either radioligand or fluorescent techniques can help assess receptor integrity . Novel approaches such as NanoBRET (using β1AR tagged with NanoLuc at the N terminus) may be adapted for Gpr26 studies .

What brain regions express Gpr26 most abundantly, and why is this distribution significant?

Gpr26 mRNA is highly expressed throughout the mouse central nervous system, with particularly abundant expression in specific regions :

  • Ventromedial hypothalamic nucleus

  • Cerebral cortex

  • Olfactory area

  • Hippocampus

  • Amygdala

This distribution pattern is significant for several reasons:

  • The high expression in ventromedial hypothalamic nucleus corresponds with Gpr26's role in regulating appetite and energy homeostasis .

  • Expression in the amygdala aligns with observed effects on anxiety and depression-like behaviors in Gpr26 knockout models .

  • The distribution shares striking similarity with endocannabinoid CB1 receptor expression patterns, suggesting possible functional relationships between these systems .

  • The conserved expression pattern across brain regions involved in emotional regulation, memory, and metabolism provides insight into Gpr26's multifaceted roles in brain function .

What molecular mechanisms underlie Gpr26's role in energy homeostasis?

Gpr26 plays a critical role in energy homeostasis through several interrelated molecular mechanisms:

  • AMPK signaling regulation: Gpr26 deficiency significantly increases hypothalamic AMPK phosphorylation at Ser172, a major activation site implicated in hyperphagia and obesity onset . This suggests Gpr26 normally inhibits AMPK activation in the hypothalamus.

  • Direct and indirect regulation pathways: Gpr26 may regulate AMPK activation through:

    • Direct pathway: Gpr26 activation stimulates intracellular cAMP production, which regulates multiple phosphorylation sites of AMPK α subunit .

    • Indirect pathway: Changes in hormone levels (insulin, leptin, adiponectin, ghrelin) resulting from Gpr26 deficiency may feedback to affect neuronal AMPK activation in the hypothalamus .

  • Interaction with endocannabinoid system: Gpr26 knockout mice exhibit hypersensitivity to rimonabant (an endocannabinoid receptor-1 antagonist), showing 21% weight loss compared to 10% in wild-type mice receiving the same treatment . This suggests a functional relationship between Gpr26 and endocannabinoid signaling in appetite regulation.

  • Energy expenditure modulation: Gpr26-deficient mice exhibit not only hyperphagia but also hypometabolism, indicating Gpr26's role in regulating both energy intake and expenditure components of energy homeostasis .

How does Gpr26 deficiency affect metabolic parameters in rodent models?

Gpr26 deficiency leads to significant metabolic alterations in rodent models, with effects particularly pronounced in female mice. Key metabolic changes include:

Metabolic ParameterEffect of Gpr26 DeficiencyGender Difference
Food intakeIncreased (hyperphagia)More pronounced in females
Energy expenditureDecreased (hypometabolism)More pronounced in females
Body weightIncreasedMore pronounced in females
Fat massSignificantly increasedPresent in both genders
Serum insulinSignificantly elevatedPresent in both genders
Serum ghrelinSignificantly decreasedPresent in both genders
Serum leptinSignificantly increasedOnly significant in females
Serum triglyceridesElevatedOnly significant in females
Serum cholesterolElevatedOnly significant in females
Glucose toleranceImpairedPresent in both genders

The metabolic phenotype of Gpr26-deficient mice includes early onset of diet-induced obesity, hyperinsulinemia, hyperleptinemia, and dyslipidemia . The gender bias observed in these metabolic alterations, while not fully understood mechanistically, parallels what has been reported in other rodent models of obesity .

What experimental approaches can identify potential endogenous ligands for orphan Gpr26?

As an orphan receptor, identifying endogenous ligands for Gpr26 represents a critical research challenge. Several experimental approaches are particularly valuable:

  • Reverse pharmacology screening: Since Gpr26 is Gs-coupled and increases cAMP production, high-throughput screening using cAMP reporter assays with tissue extracts (particularly from brain regions) may identify candidate ligands.

  • Bioinformatics-driven approaches: Leveraging Gpr26's sequence homology with serotonin receptor 5-HT5A and gastrin releasing hormone BB2 receptor to identify structurally similar ligands that might interact with Gpr26.

  • Photoaffinity labeling: Developing photoactivatable probes based on compounds showing activity at Gpr26 to capture interacting proteins in native tissues.

  • Targeted metabolomics: Comparing metabolite profiles between wild-type and Gpr26 knockout brain tissues to identify molecules that differ significantly, potentially representing endogenous ligands.

  • Proximity-based labeling: Using APEX2 or BioID fused to Gpr26 to identify proximal proteins and potential ligands in the native cellular environment.

  • Deorphanization through comparative physiology: Since Gpr26 function appears conserved from C. elegans to mammals , comparative studies across species may provide insights into potential conserved ligands.

What is the relationship between Gpr26 and anxiety/depression-like behaviors?

The molecular basis for these behavioral changes involves the PKA-CREB-NPY signaling pathway:

  • Reduced phosphorylated CREB (pCREB) levels were observed specifically in the central amygdala of Gpr26-deficient mice, while total CREB levels remained comparable between wild-type and knockout mice .

  • Previous studies have established that lower protein kinase A (PKA)–cAMP responsive element-binding protein (CREB)–neuropeptide Y (NPY) signaling in the amygdala is linked to higher anxiety in rats .

  • Since Gpr26 is coupled to Gs and increases cAMP production, its deficiency would reduce cAMP levels, thereby decreasing PKA activity and subsequent CREB phosphorylation .

This evidence suggests Gpr26 as a potential target for anxiolytic or antidepressant drugs . The connection between Gpr26's roles in both metabolic regulation and emotional behaviors is particularly interesting, as anxiety and depression are often associated with an increased risk of obesity .

What methodological considerations are important when generating recombinant Gpr26 for structural studies?

Generating recombinant Gpr26 for structural studies requires careful methodological planning:

  • Expression system selection: While non-mammalian systems provide higher yields, mammalian expression systems may better preserve structural integrity and post-translational modifications essential for Gpr26 function .

  • Construct design optimization:

    • Include stabilizing mutations identified through alanine scanning or directed evolution

    • Consider fusion partners such as T4 lysozyme or thermostabilized proteins to enhance stability

    • Engineer N and C termini to remove flexible regions while maintaining functional integrity

    • Incorporate purification tags (His or FLAG) positioned to minimize functional interference

  • Detergent selection: GPCRs are membrane proteins that require careful extraction with detergents that maintain native conformation. Initial screening with multiple detergents (DDM, LMNG, GDN) is recommended to identify optimal conditions.

  • Ligand stabilization: Although Gpr26 is orphan, addition of compounds that demonstrate activity at the receptor during purification can stabilize active conformations.

  • Lipid composition: Consider incorporating brain-specific lipids in reconstitution mixtures to better mimic the native environment of this brain-specific receptor.

  • Quality control metrics: Implement rigorous quality control using techniques like circular dichroism, fluorescence-based thermal stability assays, and functional cAMP assays to ensure the recombinant protein maintains native-like properties .

How might targeting Gpr26 offer advantages over existing anti-obesity therapies?

Targeting Gpr26 presents several potential advantages over existing anti-obesity treatments like rimonabant:

  • Improved safety profile: While rimonabant was withdrawn from the market due to psychiatric side effects including increased suicidal rates , Gpr26 activators might actually improve anxiety and depression , addressing rather than exacerbating psychological comorbidities of obesity.

  • Enhanced efficacy through dual mechanism: Gpr26 deficiency causes both hyperphagia and hypometabolism , suggesting Gpr26 activators could simultaneously reduce food intake and increase energy expenditure—a dual mechanism that many current therapies lack.

  • Gender-specific efficacy: The more pronounced effects of Gpr26 deficiency in females suggest Gpr26-targeted therapies might be particularly effective for women, who often respond differently to obesity treatments than men.

  • Potential synergistic effects: The observed hypersensitivity of Gpr26 knockout mice to rimonabant suggests potential synergistic effects between lower doses of CB1 antagonists and Gpr26 modulators, potentially reducing side effects while maintaining efficacy.

  • Specific brain region targeting: The restricted expression of Gpr26 to specific brain regions offers the potential for more targeted therapeutic approaches with fewer peripheral side effects compared to receptors expressed throughout the body.

What experimental designs best evaluate Gpr26's role in comorbid obesity and mood disorders?

To investigate Gpr26's dual role in obesity and mood disorders, research designs should incorporate:

  • Conditional knockout models: Using Cre-lox systems to delete Gpr26 in specific brain regions (hypothalamus versus amygdala) to dissect region-specific contributions to metabolic versus mood phenotypes.

  • Comprehensive behavioral battery: Implementing standardized tests for:

    • Anxiety (elevated plus maze, open field, light/dark box)

    • Depression (forced swim, tail suspension, sucrose preference)

    • Feeding behavior (meal patterns, food preference, motivation for food)

    • Energy expenditure (metabolic chambers, activity tracking)

  • Molecular phenotyping: Correlating behavioral outcomes with brain region-specific changes in:

    • AMPK phosphorylation status in hypothalamus

    • CREB phosphorylation in amygdala

    • cAMP levels across relevant brain regions

  • Pharmacological rescue experiments: Testing whether compounds that increase cAMP can rescue both metabolic and mood phenotypes in Gpr26-deficient animals.

  • Diet interaction studies: Examining how different diets (high-fat versus standard) interact with Gpr26 deficiency to influence both metabolic outcomes and anxiety/depression behaviors.

  • Longitudinal designs: Tracking the temporal relationship between onset of metabolic dysfunction and mood disturbances to determine whether one precedes and potentially causes the other.

What are the main obstacles in expressing functional recombinant rat Gpr26, and how can they be overcome?

Expressing functional recombinant Gpr26 presents several challenges with corresponding solutions:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression system, incorporate Kozak sequences and signal peptides to enhance expression

    • Solution: Test multiple expression vectors and promoters to identify optimal combinations

  • Misfolding and aggregation:

    • Solution: Express at lower temperatures (28-30°C) to slow protein synthesis and allow proper folding

    • Solution: Add chemical chaperones like glycerol or DMSO to culture media

  • Poor cell surface trafficking:

    • Solution: Create fusion constructs with well-trafficked proteins or incorporate trafficking enhancement motifs

    • Solution: Test multiple cell lines, particularly neuronal lines that naturally express GPCRs

  • Functional verification without known ligands:

    • Solution: Implement constitutive activity assays measuring basal cAMP production

    • Solution: Develop chimeric receptors incorporating domains from related GPCRs with known ligands

  • Post-translational modification differences:

    • Solution: Use mammalian expression systems that more closely recapitulate the native brain environment

    • Solution: Analyze glycosylation and phosphorylation patterns to ensure they match native receptor profiles

  • Protein stability issues:

    • Solution: Incorporate stabilizing mutations identified through structural analysis of related GPCRs

    • Solution: Add cholesterol and brain-specific lipids during purification to maintain native-like environment

How can researchers effectively measure and interpret Gpr26-mediated signaling in experimental systems?

Measuring Gpr26-mediated signaling requires specialized approaches due to its orphan status:

  • cAMP measurement techniques:

    • ELISA-based cAMP quantification

    • Real-time cAMP sensors (EPAC-based FRET biosensors)

    • GloSensor luciferase-based cAMP detection systems

    • CRE-luciferase reporter assays for downstream transcriptional responses

  • Pathway validation approaches:

    • Pharmacological interventions: Verify Gs-coupling using cholera toxin (activator) and pertussis toxin (negative control)

    • siRNA knockdown of Gαs to confirm signaling specificity

    • PKA activity assays to confirm downstream pathway activation

  • Interpretation frameworks:

    • Compare signaling kinetics with known Gs-coupled receptors

    • Establish dose-response relationships for compounds with activity at Gpr26

    • Analyze signal bias by measuring multiple downstream pathways simultaneously

  • Advanced analytical approaches:

    • Mathematical modeling of signaling kinetics

    • Principal component analysis to identify key signaling nodes

    • Machine learning algorithms to identify patterns in complex signaling datasets

  • Control experiments:

    • Include receptors with known signaling properties as positive controls

    • Generate and test signaling-dead mutants of Gpr26 as negative controls

    • Perform experiments in both native tissues and recombinant systems to compare signaling profiles

What genomic and proteomic approaches could advance understanding of Gpr26 regulation and function?

Several cutting-edge genomic and proteomic approaches could significantly advance Gpr26 research:

  • Single-cell transcriptomics: Characterize Gpr26 expression patterns at cellular resolution across brain regions to identify specific neuronal populations that express Gpr26.

  • ChIP-seq and ATAC-seq: Identify transcription factors and epigenetic mechanisms regulating Gpr26, particularly in response to metabolic status and emotional states.

  • Spatial transcriptomics: Map Gpr26 expression within complex brain structures with spatial resolution to understand its distribution in relation to other signaling systems.

  • Proteomics of Gpr26 interactome: Use proximity labeling methods (BioID, APEX) coupled with mass spectrometry to identify proteins interacting with Gpr26 in native brain tissue.

  • Phosphoproteomics: Characterize differential phosphorylation events downstream of Gpr26 activation to map signaling networks in detail.

  • CRISPR screens: Perform genome-wide CRISPR screens in neuronal cells expressing Gpr26 to identify genes affecting its expression, trafficking, and signaling.

  • Comparative genomics: Analyze Gpr26 conservation, evolution, and potential ligand binding sites across species from C. elegans to humans to identify functionally critical domains.

  • Ribosome profiling: Examine translational regulation of Gpr26 in different physiological and pathological states to understand how its expression is fine-tuned.

What are the implications of sex differences in Gpr26 function for experimental design and potential therapeutic applications?

The more pronounced phenotypic effects of Gpr26 deficiency in female mice highlight important sex-based considerations:

  • Experimental design implications:

    • Balanced sex representation: Studies should include both male and female animals with sufficient power to detect sex-specific effects

    • Hormonal considerations: Experiments should control for estrous cycle stage in females

    • Mechanism investigation: Research should specifically address molecular bases for sex differences

    • Transcript and protein quantification: Expression levels should be compared between sexes across relevant brain regions

  • Mechanistic research priorities:

    • Investigate potential estrogen/progesterone response elements in Gpr26 promoter regions

    • Examine sex hormone effects on Gpr26 expression, trafficking, and signaling

    • Study interaction between Gpr26 and sex-specific metabolic regulatory pathways

    • Explore sexual dimorphism in brain regions expressing Gpr26

  • Therapeutic implications:

    • Sex-specific dosing strategies may be required for Gpr26-targeted therapies

    • Female-specific efficacy might provide advantages for women's health applications

    • Potential for addressing sex-based disparities in treatment response for obesity and mood disorders

    • Consideration of interactions with hormone replacement therapies or contraceptives

  • Translational considerations:

    • Need for sex-stratified clinical trials for any Gpr26-targeting compounds

    • Potential for precision medicine approaches based on sex and Gpr26 genetic variants

    • Development of sex-specific biomarkers for Gpr26 activity and therapeutic response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.