Recombinant Rat Gamma-secretase subunit PEN-2 (Psenen)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant PEN-2 is produced via heterologous expression systems optimized for structural and functional fidelity:

SystemDetailsPurity
E. coliFull-length (1–101 aa) with His-tag (e.g., CSB-CF757686RA) >90%
Yeast/BaculovirusPartial constructs for specific domain studies (e.g., CSB-YP757686RA1) >85%
Mammalian CellsUsed for post-translational modifications (e.g., glycosylation) N/A

E. coli-expressed PEN-2 is most common due to high yield and cost-effectiveness, though mammalian systems enable native-like folding for functional assays .

Applications in Research

Recombinant PEN-2 is pivotal in elucidating γ-secretase mechanisms and disease pathology:

Alzheimer’s Disease Models

  • APP Processing: PEN-2 modulates Aβ42/Aβ40 ratios, a therapeutic target in AD .

  • γ-Secretase Inhibitors: Recombinant PEN-2 aids in testing inhibitors like DAPT and BMS 299897 .

Notch Signaling Studies

  • Pathway Activation: PEN-2-deficient cells show impaired Notch cleavage, linking γ-secretase dysfunction to developmental disorders .

  • Drug Development: Selective γ-secretase modulators (GSMs) spare Notch signaling, reducing off-target effects .

Mutational Impact on γ-Secretase Function

MutationRegionEffect on PS1 EndoproteolysisEffect on Activity
N33ATMD1 (N-terminal)↓ (Reduced)↓ (↓ Activity)
I53ALoop↓ (↓ Stability)↓ (↓ Activity)
D90A/F94AC-Terminal– (No effect)↓ (↓ Stability)

Data synthesized from systematic mutagenesis studies .

PEN-2’s Role in γ-Secretase Activation

  • PS1 Endoproteolysis: PEN-2 triggers PS1 cleavage, generating active N- and C-terminal fragments .

  • Complex Stabilization: The C-terminal domain prevents proteasomal degradation of PS fragments .

Clinical and Therapeutic Implications

  • Alzheimer’s Therapeutics: PEN-2’s role in Aβ42/Aβ40 modulation positions it as a target for GSMs .

  • Cancer Research: γ-Secretase inhibitors (e.g., BMS 299897) target Notch signaling in oncogenesis .

  • Rare Diseases: PSENEN haploinsufficiency causes familial acne inversa (ACNINV2), linking γ-secretase to skin pathology .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag based on feasibility.
Synonyms
Psenen; Gamma-secretase subunit PEN-2; Liver regeneration-related protein LRRGT00140; Presenilin enhancer protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP
Uniprot No.

Target Background

Function
PEN-2 is an essential component of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins, such as Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a crucial role in Notch and Wnt signaling cascades, regulating downstream processes by processing key regulatory proteins and controlling cytosolic CTNNB1 levels. PSENEN modulates both endoproteolysis of presenilin and gamma-secretase activity.
Gene References Into Functions
  1. These findings indicate that functional mature islet-like clusters can be generated through the differentiation of pancreatic precursor cell aggregates within poly(ethylene glycol)-based hydrogel cultures. PMID: 20236034
  2. Nicastrin, presenilin 1, APH-1, and PEN-2 form an active gamma-secretase complex that is expressed in mitochondria. PMID: 15456764
Database Links
Protein Families
PEN-2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.