Recombinant Rat Gap junction alpha-5 protein (Gja5)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Structural Role: Forms hexameric connexons that dock between adjacent cells to create gap junction channels .

  • Tissue Specificity: Predominantly expressed in cardiac atria, vascular endothelium, and pulmonary artery smooth muscle cells (PASMCs) .

  • Functional Domains: Contains four transmembrane domains and conserved cysteine residues critical for channel assembly .

Functional Annotations:

FunctionRelated PathwaysInteracting Partners
Gap junction channel activityCalcium regulation in cardiac cellsGJA1 (Connexin-43)
Connexin bindingGap junction assembly and traffickingMARK1, RIMS3
Electrical coupling in cardiac conductionVesicle-mediated transportCAV3 (Caveolin-3)

Experimental Uses:

  • ELISA Kits: Utilized in quantitative assays (e.g., MBS287632 kit) with a detection range of 0.312–20 ng/mL and low cross-reactivity .

  • Structural Studies: SDS-PAGE analysis confirms protein integrity and post-translational modifications .

  • Disease Models: Investigated in atrial fibrillation (AF) and hyperoxia-induced lung injury due to altered gap junction communication .

Pathological Implications:

  • Atrial Fibrillation: Reduced Gja5 expression relative to Connexin-43 (Cx43) correlates with arrhythmia susceptibility .

  • Lung Injury: Gja5 dysregulation exacerbates edema and inflammation in hyperoxia models, though mechanisms remain under investigation .

Key Studies:

  1. Cardiac Conduction: Knockout models show delayed atrial conduction and increased AF vulnerability, highlighting its role in electrical coupling .

  2. Vascular Function: Gja5 modulates pulmonary artery smooth muscle cell proliferation, impacting pulmonary hypertension progression .

Technical Considerations

  • Reconstitution: Recommended in sterile water or Tris/NaCl buffer (pH 8.0) with 5–50% glycerol for stability .

  • Quality Control: Intra- and inter-assay coefficients of variation (CV) <10% ensure reproducibility in ELISA .

Future Directions

Ongoing research focuses on:

  • Therapeutic Targeting: Modulating Gja5 expression to treat arrhythmias or pulmonary diseases.

  • Structural Biology: Cryo-EM studies to resolve channel gating mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Gja5; Cxn-40; Gap junction alpha-5 protein; Connexin-40; Cx40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-356
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Gja5
Target Protein Sequence
GDWSFLGEFLEEVHKHSTVIGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKQKLREAEKAKEAGGTG TYEYLAEKAELSCWKEVNGKIVLQGTLLNTYVCTILIRTAMEVAFMVGQYLLYGIFLDTL HVCRRSPCPHPVNCYVSRPTEKNVFIVFMMAVAGLSLFLSLAELYHLGWKKIRQRLAKSR QGDKHQLLGPSTSLVQGLTPPPDFNQCLKNSPDEKFFSDFSNNMGSRKNPDPLATEEVPN QEQIPEEGFIHTQYGQKPEQPSGASAGHRFPQGYHSDKRRLSKASSKARSDDLSV
Uniprot No.

Target Background

Function
A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which low molecular weight materials diffuse from one cell to a neighboring cell.
Gene References Into Functions

Relevant Research on Gja5:

  1. The A96S, G38D, and P88S Cx40 mutations slow conduction and increased the propensity for inducible AF. PMID: 28457700
  2. Lipopolysaccharide impairs permeability of pulmonary microvascular endothelial cells via Connexin40/protein kinase C/nfkappaB pathway. PMID: 28870649
  3. This study demonstrated that Cx40 was upregulated after traumatic brain injury in a linear correlated manner with increased oxidative stress. PMID: 28157110
  4. Data are consistent with contributions of G2 and D3 residues to Cx40 channel pore structure, but not with postulated hydrophobic W4 intermolecular interactions. Results indicate an absolute requirement for an amphipathic W3/4 residue. Alternatively, it is hypothesized that the connexin D2/3-W3/4 locus interacts with the highly conserved FIFR M1 motif to stabilize the NT domain within the pore. PMID: 27304225
  5. Data show that the ratio of peripheral blood CD4(+)/CD8(+) T lymphocytes and the levels of connexin-40 (Cx40), interleukins IL-2, IL-4 and IL-6 are significantly elevated in SH rats. PMID: 26927369
  6. Cx40 expression in mesangial cells is related to mesangial cell regeneration. PMID: 22945766
  7. The expressions of Cx40 and HCN4 increase obviously after coculturing bone marrow mesenchymal stem cells with sinoatrial node tissue. PMID: 22403875
  8. Valsartan and U0126 were equivalent on attenuating atrial fibrosis and Cx40 remodeling by inhibiting ERK pathways at different levels. PMID: 22336507
  9. Three-dimensional molecular topography and calcium-sensitive conformational changes of Connexin40 hemichannels. PMID: 21543330
  10. The study demonstrated that in the endothelium of the native vein, the gap-junctional spot numbers (GJSNs) and the total gap-junctional areas (TGJAs) of Cx40 were lower than those of the thoracic aorta. PMID: 20805582
  11. Data show heterogeneous expression of the 3 Cx isoforms Cx43, Cx45, and Cx40 in the heart. PMID: 17584645
  12. The total amount of connexins and the ratio of phosphorylated/non-phosphorylated isoforms gradually increased during the re-establishment of intercellular communication in heart myocytes. PMID: 11889564
  13. Kinetics of Cx40 voltage gating. There was a temporal correlation between development of conduction delay or block and the inactivation phase of junctional conductance. PMID: 14693688
  14. Role for Cx40 in EDHF-mediated dilation of rat mesenteric arteries. PMID: 16037574
  15. Data suggest that the HKH motif at positions 15-17 is important to the conformational structure of the putative voltage sensor and spermine receptor of Cx40. PMID: 16284078
  16. Adrenergic stimulation of cardiomyocytes can enhance connexin expression thereby increasing cellular coupling, indicating a possible role for catecholamines in the regulation of cardiac gap junction expression in cardiac disease. PMID: 16352648
  17. Structural remodeling of gap junction connexin proteins may partly underlie electrophysiological defects in STZ-induced diabetic rat sinus atrial node. PMID: 17632690
  18. Report regulation of connexin 40 gene expression during skeletal muscle regeneration in the adult rat. PMID: 19129462
  19. The selectivities of junctions formed by cells coexpressing Cx40 and Cx43 vary considerably, reflecting both their relative expression levels and phosphorylation-dependent regulation. PMID: 19465552
  20. Cx40/43 can regulate the superior mesenteric artery endothelium-dependent vascular contractive response through [Ca2+]i of vascular smooth muscle cells after hemorrhagic shock. PMID: 19588758
Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Highly expressed in lung.

Q&A

What is the basic structure of rat GJA5 and how does it compare to human GJA5?

Rat GJA5, like its human counterpart, is a membrane protein with four transmembrane domains. The human GJA5 protein consists of 358 amino acids, forming intercellular channels that enable the diffusion of low molecular weight substances between adjacent cells . When comparing rat and human GJA5:

FeatureHuman GJA5Rat GJA5
Amino Acid Length358358
Transmembrane Domains44
Molecular Weight~40 kDa~40 kDa
Sequence Homology100% (reference)~95%
Functional PropertiesForms gap junction channelsForms gap junction channels with similar properties

The four transmembrane segments are connected by two extracellular loops and one cytoplasmic loop, with both N- and C-termini located on the cytoplasmic side. This structure allows GJA5 to dock with compatible connexins on adjacent cells to form functional gap junction channels.

How should recombinant rat GJA5 be stored to maintain optimal activity?

For optimal stability of recombinant rat GJA5:

  • Store lyophilized protein at -20°C for up to 12 months

  • After reconstitution in appropriate buffer (typically PBS with 0.1% detergent):

    • For short-term use (1-2 weeks): store at 4°C

    • For long-term storage: create small aliquots and store at -80°C

    • Avoid repeated freeze-thaw cycles (limit to <3)

Buffer composition significantly affects stability. Consider:

  • pH maintenance between 7.0-7.4

  • Addition of protease inhibitors (e.g., PMSF, leupeptin)

  • Use of mild detergents (0.1% DDM or CHAPS) to maintain membrane protein structure

  • Inclusion of 10% glycerol as a cryoprotectant for frozen storage

Activity should be validated periodically using functional assays such as dye transfer experiments or electrophysiological measurements.

What expression systems are most effective for producing functional recombinant rat GJA5?

Several expression systems have been evaluated for recombinant rat GJA5 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, rapid growthPoor for membrane proteins, lacks PTMsLow (0.1-0.5 mg/L)
Insect cells (Sf9, Hi5)Better folding, some PTMsMore complex, moderate costModerate (1-3 mg/L)
Mammalian cells (HEK293, CHO)Native-like folding, complete PTMsExpensive, slower growthModerate (0.5-2 mg/L)
Cell-free systemsAvoids toxicity issuesExpensive, variable activityLow-moderate

For functional rat GJA5, mammalian expression systems typically provide the most physiologically relevant product. HEK293 cells are particularly effective as they:

  • Process transmembrane proteins efficiently

  • Provide appropriate post-translational modifications

  • Can be transiently transfected with high efficiency

  • Express chaperones that assist proper folding

Insect cell systems using baculovirus vectors offer a good compromise between yield and functional quality. When designing expression constructs, consider including:

  • A cleavable N-terminal signal sequence

  • A C-terminal purification tag (His6 or FLAG)

  • Codon optimization for the expression host

What purification strategies minimize aggregation of recombinant rat GJA5?

Purifying membrane proteins like rat GJA5 while maintaining their native structure requires careful handling:

  • Solubilization protocol:

    • Use mild detergents (DDM, LMNG, or digitonin at 1-2% w/v)

    • Include 10-20% glycerol as a stabilizer

    • Maintain physiological ionic strength (150-300 mM NaCl)

    • Perform solubilization for 1-2 hours at 4°C with gentle rotation

  • Chromatography strategy:

    • Initial capture: IMAC (for His-tagged constructs)

    • Intermediate: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Critical aggregation prevention measures:

    • Maintain detergent above CMC throughout purification

    • Keep samples at 4°C during all steps

    • Include 5-10% glycerol in all buffers

    • Consider adding specific lipids (0.01-0.05% w/v)

    • Filter solutions through 0.22 μm membranes before chromatography

  • Quality control assessment:

    • Dynamic light scattering to confirm monodispersity

    • Size exclusion chromatography to verify oligomeric state

    • SDS-PAGE with and without reducing agents

    • Western blotting to confirm identity

For higher-resolution structural studies, consider reconstituting purified GJA5 into nanodiscs, which better mimic the native membrane environment and improve stability.

What are the most reliable methods for assessing the channel activity of recombinant rat GJA5?

When evaluating channel functionality of recombinant rat GJA5, consider these established techniques:

  • Dye transfer assays:

    • Microinjection of Lucifer Yellow (MW 457 Da)

    • FRAP (Fluorescence Recovery After Photobleaching) with calcein-AM

    • Quantification of dye spread between cells expressing GJA5

    • Advantages: Visually intuitive, can be performed in living cells

    • Limitations: Indirect measure, affected by dye properties

  • Electrophysiological measurements:

    • Dual whole-cell patch clamp recordings

    • Quantification of junctional conductance

    • Measurement of voltage-gating properties

    • Advantages: Direct functional assessment, high temporal resolution

    • Limitations: Technically demanding, low throughput

  • Reconstitution into artificial systems:

    • Planar lipid bilayers with purified protein

    • Liposome-based flux assays

    • Advantages: Defined composition, isolation from other cellular factors

    • Limitations: May not fully recapitulate native environment

For quantitative comparison across experiments, standardized parameters should include:

  • Single channel conductance (typically 120-160 pS for GJA5)

  • Voltage gating characteristics (V₁/₂ and Gmin values)

  • Permeability ratios for different molecules

  • Response to regulatory factors (pH, Ca²⁺, phosphorylation)

How can researchers distinguish between effects on GJA5 trafficking versus channel function?

Distinguishing between trafficking defects and functional alterations requires systematic experimental design:

  • Subcellular localization analysis:

    • Immunofluorescence microscopy with antibodies against GJA5

    • Live-cell imaging with GFP-tagged GJA5

    • Colocalization with plasma membrane markers (Na⁺/K⁺-ATPase)

    • Colocalization with organelle markers (ER: calnexin; Golgi: GM130)

  • Biochemical fractionation:

    • Separation of plasma membrane, cytosolic, and organelle fractions

    • Western blot analysis of GJA5 distribution

    • Surface biotinylation assays to quantify membrane-localized protein

  • Trafficking kinetics:

    • Pulse-chase experiments with metabolic labeling

    • Brefeldin A treatment to block ER-to-Golgi transport

    • Photoactivatable GJA5 constructs to track movement

  • Functional assessment of properly trafficked channels:

    • Electrophysiological recording with simultaneous visualization

    • Correlation of plaque size with functional coupling

    • Single-molecule tracking combined with functional assays

  • Evaluation matrix to distinguish defects:

ObservationTrafficking DefectFunctional DefectBoth
Reduced membrane localizationHighLowModerate
Normal membrane localization but reduced couplingLowHighLow
Altered plaque morphologyHighVariableHigh
Altered single channel conductanceLowHighVariable
Response to trafficking enhancersImprovedNo changePartial improvement

How does recombinant rat GJA5 contribute to models of atrial fibrillation?

Recombinant rat GJA5 has been instrumental in understanding the molecular basis of atrial fibrillation (AF), with several experimental approaches:

  • In vitro cellular models:

    • Transfection of cardiac cell lines or primary cardiomyocytes with wild-type or mutant rat GJA5

    • Assessment of conduction velocity using optical mapping techniques

    • Measurement of action potential propagation and heterogeneity

    • Evaluation of arrhythmogenic susceptibility under stress conditions

  • Ex vivo tissue preparations:

    • Langendorff-perfused rat heart preparations

    • Microinjection or viral delivery of recombinant GJA5 constructs

    • Optical mapping of atrial conduction

    • Programmed electrical stimulation to assess arrhythmia inducibility

  • In vivo rodent models:

    • Transgenic expression of mutant GJA5 forms

    • Adenoviral-mediated delivery of GJA5 variants

    • Telemetric ECG monitoring for spontaneous arrhythmias

    • Electrophysiological studies with programmed stimulation

Mutations in GJA5 have been identified in patients with AF . Recombinant expression of these mutants allows researchers to characterize:

  • Changes in channel conductance

  • Alterations in voltage gating properties

  • Dominant-negative effects on wild-type channels

  • Protein-protein interactions with other cardiac connexins

This information helps establish mechanistic links between GJA5 dysfunction and the development of atrial arrhythmias.

What role does GJA5 play in pulmonary function and lung injury models?

GJA5 is expressed in pulmonary artery smooth muscle cells (PASMCs) and has been implicated in edema and inflammation during certain lung injuries . Experimental approaches to study this include:

  • Acute lung injury models:

    • Hyperoxia-induced lung injury in rats

    • Lipopolysaccharide (LPS)-induced inflammation

    • Ventilator-induced lung injury models

    • Assessment of GJA5 expression changes and localization

  • Functional studies in isolated pulmonary vessels:

    • Wire myography of pulmonary arteries

    • Pressure myography to assess vasoreactivity

    • Gap junction inhibitor studies (carbenoxolone, Gap27 peptides)

    • Correlation of GJA5 function with vascular tone

  • Cell-specific investigations:

    • Primary PASMC cultures with GJA5 knockdown or overexpression

    • Co-culture systems with endothelial cells and PASMCs

    • Calcium imaging to assess intercellular communication

    • Inflammatory mediator production and response

  • Therapeutic targeting approaches:

    • Connexin mimetic peptides targeting GJA5

    • siRNA or antisense approaches for selective inhibition

    • Pharmacological modulators of gap junction function

    • Assessment of edema formation and inflammatory marker expression

These approaches help elucidate whether GJA5 channel activity contributes to the pathogenesis of acute lung injury or serves a protective role, potentially identifying new therapeutic targets.

How can researchers effectively study the interaction between GJA5 and other connexin proteins?

Studying heterotypic and heteromeric interactions between GJA5 and other connexins requires sophisticated approaches:

  • Co-expression systems:

    • Controlled expression of multiple connexins with different fluorescent tags

    • Tetracycline-inducible systems for temporal control

    • Quantitative analysis of co-localization at gap junctions

    • FRET/BRET analysis for protein proximity

  • Biochemical interaction studies:

    • Co-immunoprecipitation with antibodies against specific connexins

    • Proximity ligation assays for detection of interacting proteins

    • Cross-linking followed by mass spectrometry analysis

    • Blue native PAGE to preserve native protein complexes

  • Functional characterization of heterotypic channels:

    • Paired oocyte or cell expression systems

    • Selective expression of different connexins in apposing cells

    • Electrophysiological characterization of resulting channels

    • Dye transfer studies with size-selective tracers

  • Analysis matrix for heterotypic GJA5 interactions:

Partner ConnexinCompatibleFunctional PropertiesPhysiological Significance
Cx43 (GJA1)YesAsymmetric voltage gatingAtrial-ventricular conduction
Cx45 (GJC1)YesReduced conductanceSinoatrial and AV node function
Cx37 (GJA4)YesModified ion selectivityEndothelial-VSMC coupling
Cx32 (GJB1)NoN/AN/A
  • Advanced imaging approaches:

    • Super-resolution microscopy (STORM, PALM)

    • Single-molecule tracking of connexin mobility

    • Correlative light and electron microscopy

    • Live-cell imaging of connexin trafficking and assembly

These techniques help determine how GJA5 interactions with other connexins affect channel properties, regulation, and physiological function in different tissues.

What methodological approaches can resolve contradictory findings about GJA5 phosphorylation states?

Contradictory findings regarding GJA5 phosphorylation often stem from methodological differences. Resolving these requires:

  • Comprehensive phosphosite mapping:

    • High-resolution mass spectrometry (MS/MS)

    • Enrichment of phosphopeptides prior to analysis

    • Site-directed mutagenesis of potential phosphorylation sites

    • Comparison across species and experimental conditions

  • Kinase-specific approaches:

    • In vitro kinase assays with purified components

    • Pharmacological inhibitors with varying specificity

    • Genetic approaches (kinase knockdown/knockout)

    • Phospho-specific antibodies for key residues

  • Contextual considerations:

    • Cell type-specific effects (heterologous vs. native systems)

    • Acute vs. chronic stimulation protocols

    • Consideration of connexin life cycle stage

    • Integration with other post-translational modifications

  • Functional correlation:

    • Phosphomimetic and phospho-null mutations

    • Single-channel recordings to assess functional effects

    • Trafficking and assembly studies

    • Half-life and degradation pathway analysis

  • Standardized reporting recommendations:

    • Detailed methodological documentation

    • Specification of cell types and conditions

    • Quantification of phosphorylation stoichiometry

    • Time-course studies to capture dynamic changes

By systematically addressing these factors, researchers can reconcile divergent findings about GJA5 phosphorylation and develop a more integrated understanding of how this modification regulates gap junction function in different physiological contexts.

How can CRISPR/Cas9 genome editing enhance studies of rat GJA5 function?

CRISPR/Cas9 technology offers powerful approaches for studying rat GJA5:

  • Generation of precise genetic models:

    • Knock-in of disease-associated mutations

    • Introduction of reporter tags (GFP, luciferase) at endogenous loci

    • Creation of conditional alleles with loxP or FRT sites

    • Tissue-specific promoter replacements

  • High-throughput functional screening:

    • CRISPR library screens targeting GJA5 regulatory elements

    • Identification of essential interacting partners

    • Screens for compounds that rescue mutant GJA5 function

    • Discovery of novel regulatory mechanisms

  • Technical considerations for GJA5 editing:

    • sgRNA design to minimize off-target effects

    • HDR template design for precise modifications

    • Verification strategies (sequencing, Western blotting, functional assays)

    • Clonal isolation and characterization

  • Applications in primary cells and organoids:

    • Direct editing in primary rat cardiomyocytes

    • Creation of cardiac organoids with GJA5 variants

    • Electrophysiological phenotyping of edited tissues

    • Drug screening in genetically defined models

CRISPR/Cas9 approaches enable more physiologically relevant studies by manipulating GJA5 in its native genomic context, avoiding artifacts associated with overexpression systems and allowing the study of tissue-specific regulatory elements.

What are the most promising approaches for studying the role of GJA5 in cardiac conduction disorders?

Advanced approaches for investigating GJA5 in cardiac conduction disorders include:

  • Patient-derived models:

    • iPSC-derived cardiomyocytes from patients with GJA5 mutations

    • CRISPR correction of mutations to establish isogenic controls

    • Multielectrode array recordings of conduction properties

    • Pharmacological challenge to reveal arrhythmia susceptibility

  • Tissue-engineered cardiac models:

    • 3D bioprinting with controlled GJA5 expression

    • Engineered anisotropy to mimic native conduction pathways

    • Optical mapping of action potential propagation

    • Integration of mechanical and electrical stimulation

  • In vivo electrophysiological approaches:

    • Telemetric monitoring in genetically modified rats

    • Optical mapping in Langendorff-perfused hearts

    • Programmed electrical stimulation protocols

    • Regional heterogeneity assessment

  • Computational modeling integration:

    • Multi-scale models incorporating molecular GJA5 properties

    • Virtual tissue models for arrhythmia simulation

    • Parameter sensitivity analysis

    • Prediction of anti-arrhythmic strategies

  • Translational therapeutic approaches:

    • Antisense oligonucleotides for isoform-specific modulation

    • Small molecule modifiers of GJA5 function

    • Gene therapy approaches for mutation correction

    • AAV-mediated delivery of optimized GJA5 constructs

These integrated approaches link molecular defects in GJA5 to tissue-level electrical abnormalities and whole-organ arrhythmias, potentially identifying new therapeutic targets for cardiac conduction disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.