Recombinant Rat Gap junction alpha-6 protein (Gja6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Gap Junction Alpha-6 Protein (Gja6)

Recombinant Rat Gap Junction Alpha-6 Protein (Gja6), also known as Connexin-33 (Cx33), is a transmembrane protein critical for intercellular communication via gap junction channels. These channels allow the direct exchange of ions, metabolites, and signaling molecules between adjacent cells. Gja6 belongs to the connexin family (group II alpha-type subfamily) and is expressed in tissues such as the testis, where it regulates germ cell proliferation .

Functional Studies

Recombinant Gja6 is used to investigate gap junction assembly, trafficking, and channel properties:

  • Oligomerization: Forms hexameric hemichannels (connexons) that dock with adjacent cells to create functional channels .

  • Electrophysiology: Studies of channel conductance and selectivity in lipid bilayers or transfected cells .

  • Trafficking: Analysis of post-translational modifications (e.g., phosphorylation) affecting membrane localization .

Tissue-Specific Roles

In the testis, Gja6 interacts with Connexin-43 (Cx43) to regulate spermatogonial proliferation. Knockout studies in mice show no compensatory upregulation of Gja6 in Cx43-deficient germ cells, suggesting distinct roles .

Challenges and Future Directions

  • Stability: Recombinant Gja6 requires careful handling to avoid aggregation or degradation. Repeated freeze-thaw cycles are discouraged .

  • Functional Reconstitution: Challenges in reconstituting functional channels in artificial membranes limit mechanistic studies .

  • Tissue-Specific Functions: Further research is needed to elucidate Gja6’s role in embryonic development and disease models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gja6; Cxn-33; Gap junction alpha-6 protein; Connexin-33; Cx33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Gja6
Target Protein Sequence
MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPG CENVCYDQAFPISHVRLWVLQVIFVSVPTLLHLAHVYYVIRQNEKLKKQEEEELKVAHFN GASGERRLQKHTGKHIKCGSKEHGNRKMRGRLLLTYMASIFFKSVFEVAFLLIQWYLYGF TLSAVYICEQSPCPHRVDCFLSRPTEKTIFILFMLVVSMVSFVLNVIELFYVLFKAIKNH LGNEKEEVYCNPVELQKPSCVSSSAVLTTICSSDQVVPVGLSSFYM
Uniprot No.

Target Background

Function
A gap junction is comprised of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low molecular weight materials diffuse from one cell to an adjacent cell.
Gene References Into Functions
  1. Data demonstrate that in the testis, connexin33 plays a specific role in germ cell proliferation by suppressing the regulatory effect of connexin43. PMID: 15331631
  2. Cx33 and Cx43 genes are regulated differently within the testis, suggesting that these two connexins may exert opposing and complementary effects on spermatogenesis. PMID: 16236818
Database Links

KEGG: rno:54256

UniGene: Rn.209042

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in testis.

Q&A

What is Gap Junction Alpha-6 protein and what are its primary functions?

Gap Junction Alpha-6 protein (Gja6) belongs to the connexin family and is predicted to enable gap junction channel activity. Based on cellular component analysis, Gja6 is a component of the connexin complex that forms intercellular channels in gap junctions, mediating cell-cell communication . Like other connexin family members, Gja6 is located in the plasma membrane and specifically in anchoring junctions. The protein is part of the structural organization that allows direct communication between adjacent cells through the exchange of small molecules and ions.

Similar to other connexins such as Gja5 (which forms intercellular connexin channels in gap junctions), Gja6 likely plays a crucial role in tissue homeostasis and coordination of cellular activities through direct communication between adjacent cells .

How does Gja6 localization influence its function in tissue systems?

Gja6 has been identified in several cellular components that directly impact its functionality:

Cellular ComponentRelationshipEvidence TypeSource
Anchoring junctionlocated_inIEAUniProtKB-KW:KW-0965
Connexin complexpart_ofIBAMGI:2384150
Gap junctionlocated_inIEAUniProtKB-SubCell:SL-0124
Plasma membranelocated_inIEAUniProtKB-KW:KW-1003

The localization pattern indicates that Gja6 is integrated into the plasma membrane at specific junction sites, particularly gap junctions . This strategic positioning allows the protein to participate in forming intercellular channels, which are critical for coordinated cellular activities. When studying Gja6, researchers should employ methodologies that preserve membrane integrity and junction structures to accurately assess its functional characteristics.

What CRISPR-based approaches are available for manipulating Gja6 expression?

The laboratory of Feng Zhang at the Broad Institute has designed specific gRNA sequences that efficiently target the Gja6 gene with minimal risk of off-target Cas9 binding within the mouse genome . When implementing CRISPR-based manipulation of Gja6, researchers should consider the following methodological approach:

  • Select at least two gRNA constructs per gene to increase success probability

  • Verify gRNA sequences against your specific target gene sequence before ordering, particularly if targeting specific splice variants or exons

  • Utilize vectors that include appropriate selection markers for your experimental system

  • Confirm successful genomic editing through sequencing

For effective gene knockout studies, researchers should ensure their CRISPR constructs contain all essential elements: U6 promoter, spacer (target) sequence, gRNA scaffold, and terminator . The experimental design should include appropriate controls to validate the specificity and efficiency of the CRISPR targeting.

What methods are recommended for analyzing Gja6 expression patterns in tissue samples?

To effectively study Gja6 expression patterns, researchers should implement a multi-level analysis approach:

  • Transcriptomic analysis: Utilize microarray or RNA-seq approaches similar to those used for other connexins. The Affymetrix and Illumina platforms have been successfully employed to analyze connexin expression in large cohorts (approximately 2000 patients), demonstrating robust cross-validation between platforms .

  • Protein detection: Immunohistochemistry on tissue microarrays (TMAs) can provide spatial information about Gja6 expression. For other connexins like Cx43 and Cx30, protein detection has proven to be an independent prognostic marker in diseases such as breast cancer .

  • Correlation analysis: Statistical methods including Spearman-rank test can be used to correlate Gja6 expression with other biological parameters, while Kaplan-Meier plots can assess potential prognostic relevance .

When analyzing connexin expression, researchers should be aware that mRNA and protein levels may not always correlate, suggesting complex post-transcriptional and post-translational regulation mechanisms .

How can recombinant Gja6 be purified and characterized for functional studies?

For optimal purification and characterization of recombinant Gja6, researchers can apply methodologies similar to those used for other connexin family proteins such as Gja5:

  • Expression system selection: E. coli has been successfully used for the expression of rat connexin proteins with N-terminal His tags .

  • Purification protocol:

    • Utilize affinity chromatography leveraging the His-tag

    • Implement a buffer system containing 20mM Tris, 150mM NaCl, pH 8.0

    • Consider adding stabilizing agents such as 1mM EDTA, 1mM DTT, and 5% Trehalose

    • Avoid harsh detergents; 0.01% sarcosyl has been effective for other connexins

  • Quality assessment:

    • Verify purity (>98%) using SDS-PAGE under reducing conditions

    • Determine molecular mass (expected range: 20-30 kDa based on similar connexins)

    • Confirm proper folding through functional assays

    • Assess endotoxin levels (<1.0EU per 1μg determined by LAL method)

  • Stability characterization:

    • Perform accelerated thermal degradation tests (37°C for 48h)

    • Monitor for degradation and precipitation

    • Establish appropriate storage conditions (aliquot and store at -80°C for extended periods)

What approaches should be used to investigate potential interactions between Gja6 and other connexin family members?

Given that connexins can form heteromeric and heterotypic channels, investigating Gja6 interactions requires sophisticated methodological approaches:

  • Co-immunoprecipitation (CoIP): This technique can identify direct protein-protein interactions between Gja6 and other connexin family members .

  • Proximity ligation assays: These can visualize protein-protein interactions in situ with high sensitivity and specificity.

  • FRET analysis: Förster resonance energy transfer can assess close proximity between labeled connexin proteins in living cells.

  • Electrophysiological studies: Patch-clamp analysis and dye transfer assays can evaluate the functional consequences of Gja6 interactions with other connexins.

When designing these experiments, researchers should consider that connexins within subfamilies can form homo- and heterocellular epithelial channels, as demonstrated for other connexin family members .

What genotyping strategies are recommended for confirming successful Gja6 deletion or modification?

Based on approaches used for other connexin genes like Gja1, researchers should implement a comprehensive genotyping strategy:

  • PCR genotyping: Using genomic DNA from tissue samples:

    • Design primers to detect Cre recombinase expression

    • Create primers that identify loxP sites flanking the Gja6 gene

    • Consider mice with Cre-positive expression and both alleles flanked by loxP sites ("homoflox") as homozygous knockout models

  • Confirmation PCR: To verify deletion of floxed alleles:

    • Design primers that generate amplicons spanning the junction between intron and inserted reporter genes (e.g., lacZ)

    • This approach has been successfully used to confirm Cx43 deletion in testicular tissue

  • Protein expression analysis: Western blotting and immunohistochemistry should be used as secondary verification methods to confirm the absence of Gja6 protein.

What phenotypic assessments should be conducted following Gja6 deletion or modification?

When evaluating phenotypic consequences of Gja6 manipulation, researchers should implement a systematic assessment approach:

  • Physiological parameters:

    • Monitor body weight and organ-specific weights

    • Calculate relative organ weights to normalize for body size variations

    • Compare these measurements between knockout and wild-type animals

  • Histological analysis:

    • Examine tissue architecture in organs where Gja6 is expressed

    • Assess cell composition and organization

    • Evaluate potential compensatory changes in other connexin family members

  • Functional testing:

    • Design tissue-specific functional assays based on the known or predicted role of Gja6

    • Consider comparative analysis with phenotypes observed in other connexin knockout models

    • Examine both homozygous and heterozygous models to assess gene dosage effects

When interpreting results, researchers should be aware that functional redundancy among connexin family members may mask phenotypic effects, as demonstrated by the dispensability of Cx43 in certain contexts despite its widespread expression .

What are the critical quality control parameters for recombinant Gja6 protein preparations?

When working with recombinant Gja6 protein, researchers should evaluate the following quality parameters:

  • Purity assessment:

    • SDS-PAGE analysis under reducing conditions should demonstrate >98% purity

    • Verify expected molecular weight (likely in the 20-30 kDa range based on similar connexins)

  • Stability verification:

    • Accelerated thermal degradation tests (37°C for 48h)

    • Loss rate should be less than 5% within the expiration date under appropriate storage conditions

    • Monitor for visible precipitation or aggregation

  • Endotoxin testing:

    • Using LAL method, endotoxin levels should be <1.0EU per 1μg of protein

    • This is particularly important for applications involving cell culture or in vivo studies

  • Functional activity:

    • Application-specific assays to confirm biological activity

    • For example, verification of proper folding through circular dichroism or limited proteolysis

How should inconsistencies between mRNA and protein expression data for Gja6 be interpreted?

Research on other connexins has revealed that mRNA and protein levels do not always correlate, suggesting complex regulation mechanisms. When facing such discrepancies:

  • Methodological considerations:

    • Verify the specificity of antibodies used for protein detection

    • Ensure RNA probes are specific to the Gja6 transcript of interest

    • Consider different quantification methods to confirm observations

  • Biological interpretation:

    • Investigate potential post-transcriptional regulation (microRNAs, RNA-binding proteins)

    • Assess protein stability and turnover rates

    • Examine subcellular localization, as protein may be synthesized but incorrectly trafficked

Research on connexins such as Cx46, Cx26, and Cx32 has demonstrated that prognostic correlations found at mRNA level can be lost or even discordant at protein level, suggesting significant post-transcriptional/translational control mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.