Recombinant Rat Gap junction alpha-8 protein (Gja8)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Rat Gap Junction Alpha-8 Protein (Gja8), also known as connexin 50 (Cx50), is a transmembrane protein critical for forming gap junction channels. These channels facilitate intercellular communication by allowing the passage of ions, metabolites, and signaling molecules (≤1 kDa) between adjacent cells . In the lens, Gja8 is essential for maintaining transparency and regulating growth/maturation of fiber cells .

Research Applications

Recombinant rat Gja8 is primarily studied using:

  • AAV Vectors: The pAAV-G-CMV-amp system enables transient overexpression in mammalian cells (e.g., HeLa) .

  • CRISPR/Cas9 Models: Knockout studies in rabbits revealed microphthalmia and disrupted lens gap junctions .

  • Xenopus Oocyte Assays: Used to assess channel functionality and dominant-negative effects of mutants .

Key Findings from Experimental Models:

  • Knockout Rabbits:

    • Phenotype: Microphthalmia, cataracts, and reduced lens size .

    • Gap Junction Morphology: Smaller, irregular junctions compared to wild-type .

  • HeLa Cell Transfection:

    • Mutants (e.g., W4R) accumulate in the cytoplasm, failing to form functional plaques .

Clinical and Therapeutic Relevance

  • Cataract Pathogenesis: Over 20 GJA8 mutations are linked to congenital cataracts, often via dominant-negative effects .

  • Drug Development: Rabbit GJA8 knockout models serve as tools for screening cataract therapeutics .

Challenges and Future Directions

  • Temperature Sensitivity: Some mutants (e.g., P88G) show partial rescue at lower temperatures .

  • Gene Therapy: AAV-mediated delivery of wild-type GJA8 could restore lens homeostasis in mutants .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
Gja8; Gap junction alpha-8 protein; Connexin-50; Cx50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-440
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Gja8
Target Protein Sequence
GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHHVRMEEKRKDREAEELCQQSRSN GGERVPIAPDQASIRKSSSSSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYG FRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFMLSVAFVSLFLNIMEMSHLGMKGIRS AFKRPAEQPLGEIAEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLSA KPFSQFEEKIGTGPLADMSRGYQETLPSYAQVGAQEVEREEQPVEEAVEPEVGEKKQEAE KVAPEGQETVAVPDGEKVETPGVGKDDEKEELQAEKVTKQGLSAEKAPTLCPELTTDDNR PLSRLSKASSRARSDDLTI
Uniprot No.

Target Background

Function
Gap junction alpha-8 protein (Gja8) is a structural component of eye lens gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjacent cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell through the central pore.
Database Links
Involvement In Disease
Defects in Gja8 are the cause of cataract.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Detected in eye lens (at protein level).

Q&A

What is Gap junction alpha-8 protein (Gja8) and what are its alternative nomenclatures in scientific literature?

Gap junction alpha-8 protein (Gja8), commonly known as Connexin 50 (Cx50), is a transmembrane protein that forms gap junction channels between adjacent cells. In scientific literature, it may be referenced under several alternative names including CAE, CAE1, CX50, CZP1, MP70, and CTRCT1. In rat tissue specifically, it is often referred to as Lens fiber protein MP70 or lens intrinsic membrane protein MP70 . The human Gja8 ortholog consists of 433 amino acid residues with a molecular mass of approximately 48.2 kilodaltons and shows high sequence conservation with rat Gja8, particularly in functional domains .

What is the physiological significance of Gja8 in normal tissue function?

Gja8 plays critical roles in multiple physiological processes:

  • Lens development and transparency: Gja8 is essential for proper lens growth and the maturation of lens fiber cells. Studies using knockout mouse models demonstrate that homozygous deletion of Gja8 (α8−/−) results in significantly smaller lenses with zonular pulverulent nuclear cataracts .

  • Intercellular communication: As a component of gap junction channels, Gja8 facilitates the direct cytoplasmic exchange of ions and low molecular weight metabolites between adjacent cells. This communication is crucial for coordinating cellular activities in tissues where Gja8 is expressed .

  • Calcium and pH sensing: Gja8 functions in a calcium and pH-dependent manner, allowing cells to respond to changes in their microenvironment by modulating intercellular communication .

  • Uniform protein distribution: Research with GFP-transgenic mice has shown that Gja8 contributes to the uniform distribution of proteins between differentiated lens fiber cells, which is important for maintaining lens homeostasis .

How does Gja8 expression differ across tissues and developmental stages?

Expression data indicates that Gja8 shows tissue-specific and developmental expression patterns:

Tissue TypeExpression LevelDevelopmental StageCitation
Eye lens fiber cellsHighIncreases during fiber differentiation
Lens epithelial cellsModeratePresent throughout development
Other ocular tissuesLow/Negligible-
BrainDetectable (in mouse/rat)-

Unlike some other connexins that show broad tissue distribution, Gja8 expression is predominantly restricted to the eye, with particularly high expression in lens fiber cells . During lens development, Connexin α8 expression increases significantly during fiber cell differentiation, contributing to the formation of the extensive gap junction network required for lens transparency .

What are the most effective methods for detecting and quantifying endogenous Gja8 in rat tissue samples?

Multiple validated methodologies can be employed for detection and quantification of endogenous Gja8:

  • Western Blot analysis:

    • Optimal dilution range: 1:500-1:5000 of primary antibody

    • Expected band size: 49 kDa

    • Positive control tissues: Rat brain tissue

    • Loading control recommendations: β-actin or GAPDH

  • Immunohistochemistry (IHC):

    • Recommended dilution: 1:20-1:200

    • Antigen retrieval: Heat-mediated in citrate buffer (pH 6.0)

    • Detection systems: HRP/DAB or fluorescent secondary antibodies

    • Counterstaining: Hematoxylin for contrast

  • Immunofluorescence (IF):

    • Optimal dilution: 1:50-1:200

    • Fixation: 4% paraformaldehyde

    • Permeabilization: 0.1% Triton X-100

    • Counterstaining: DAPI for nuclear visualization

  • ELISA:

    • Can be used for quantitative analysis from tissue homogenates

    • Sensitivity range typically in pg/ml to ng/ml

When analyzing Gja8 in lens tissue, it's important to note that sample preparation requires careful consideration due to the high protein content and unique biochemical properties of lens fiber cells.

What expression systems are most suitable for producing functional recombinant rat Gja8 protein?

The choice of expression system significantly impacts the yield and functionality of recombinant Gja8:

Expression SystemAdvantagesLimitationsOptimization Strategies
Mammalian (HEK293, CHO)- Native post-translational modifications
- Proper membrane insertion
- Formation of functional channels
- Lower yield
- Higher cost
- Longer production time
- Use inducible expression systems
- Codon optimization
- Addition of chaperones
Insect cells (Sf9, Hi5)- Higher yield than mammalian
- Some post-translational modifications
- Good for structural studies
- Some modifications differ from native
- May require optimization
- Baculovirus optimization
- Temperature adjustment
- Harvest time optimization
E. coli- High yield
- Cost-effective
- Rapid production
- Lack of post-translational modifications
- Inclusion body formation
- Refolding challenges
- Fusion tags (MBP, SUMO)
- Low temperature induction
- Specialized strains

For functional studies requiring properly folded and assembled connexins, mammalian expression systems are generally preferred despite lower yields. When producing fragments for antibody production or binding studies, prokaryotic systems may be sufficient. Commercial recombinant protein fragments are available for specific domains, such as amino acids 97-148 and 251-397, which can be used as controls in antibody validation studies .

How can researchers validate the functionality of recombinant Gja8 in experimental systems?

Functional validation of recombinant Gja8 requires multiple complementary approaches:

  • Gap junction communication assays:

    • Dye transfer: Using gap junction-permeable fluorescent dyes like Lucifer Yellow

    • Metabolite transfer: Measuring passage of small molecules such as ATP or cAMP

    • Electrical coupling: Patch-clamp techniques to measure electrical conductance

  • Channel properties assessment:

    • pH sensitivity: Testing channel conductance at various pH values (typically 6.5-7.5)

    • Calcium sensitivity: Measuring channel function at different calcium concentrations

    • Voltage gating: Examining voltage-dependent gating behaviors characteristic of Gja8

  • Protein-protein interaction validation:

    • Co-immunoprecipitation with known binding partners

    • Proximity ligation assays to confirm interactions in situ

    • FRET/BRET analyses for studying dynamics of interactions

  • Structural confirmation:

    • Circular dichroism to assess secondary structure

    • Protease protection assays to confirm proper membrane topology

    • Native PAGE to verify hexameric assembly

Research has shown that functionality of Gja8 channels is significantly affected by mutations, post-translational modifications, and interactions with regulatory proteins such as calmodulin, which binds in a calcium-dependent manner .

How does the structure of rat Gja8 compare to other connexin family members?

Rat Gja8, like other connexins, shares a common structural architecture while maintaining unique features:

Structural ComponentCommon FeaturesGja8-Specific Characteristics
N-terminal domain- Located in cytoplasm
- Critical for voltage gating
- Contains key regulatory residues
- Second amino acid influences gating polarity
- Forms part of the channel pore when inserted
Transmembrane domains (TM1-4)- Four membrane-spanning α-helices
- TM1 lines channel pore
- Highly conserved
- TM1 and TM2 contain residues critical for Gja8-specific permeability
Extracellular loops (E1, E2)- Contain conserved cysteine residues
- Essential for docking between cells
- Determine compatibility
- E1 of Gja8 contains domains important for calcium sensing
Cytoplasmic loop- Located between TM2 and TM3
- Regulatory region (L2 domain)
- Binding site for partners
- Contains calmodulin binding domain
- Distinct pH sensitivity profile
C-terminal domain- Highly variable among connexins
- Contains regulatory sites
- Intrinsically disordered region
- Contains residues 251-397 used as antigenic regions
- Has unique phosphorylation sites

Which domains of Gja8 are critical for channel function, and how do targeted mutations affect these functions?

Specific domains of Gja8 play crucial roles in channel function, with mutations causing distinct functional effects:

  • N-terminal domain:

    • Function: Forms part of the channel pore and influences voltage gating

    • Critical mutations: Alterations in the second amino acid position affect gating polarity

    • Functional consequences: Changes in voltage sensitivity and channel conductance

  • First transmembrane domain (TM1):

    • Function: Lines the channel pore and determines conductance properties

    • Critical regions: Amino acids facing the pore lumen

    • Functional consequences of mutation: Altered pore size, selectivity, and permeability

  • Extracellular loops:

    • Function: Mediate docking between hemichannels of adjacent cells

    • Critical residues: Conserved cysteine residues forming disulfide bonds

    • Functional consequences of mutation: Failure of hemichannel docking, resulting in cataract formation

  • Cytoplasmic loop (CL):

    • Function: Contains the L2 region that interacts with the C-terminal domain

    • Critical region: Second half of the loop (L2)

    • Functional consequences of mutation: Disrupted pH and calcium sensitivity

  • C-terminal domain:

    • Function: Regulates channel gating and protein interactions

    • Critical regions: Calmodulin binding domains, phosphorylation sites

    • Functional consequences of mutation: Altered regulation by calcium, pH, and kinases

The importance of these domains is evidenced by studies of Gja8 knockout and knock-in mice. For example, research has shown that heterozygous knockout mice develop normally with transparent lenses, while homozygous knockouts develop zonular pulverulent nuclear cataracts, demonstrating the dose-dependent relationship between functional Gja8 and lens development .

What structural features determine the permeability and selectivity of Gja8 channels?

The permeability and selectivity of Gja8 channels are determined by multiple structural elements:

  • Pore-lining residues:

    • The channel pore is primarily lined by residues from the first transmembrane domain (TM1) and the N-terminal domain

    • Charged and polar residues create an electrostatic environment that influences which molecules can pass through

    • The specific arrangement of these residues in Gja8 creates a distinctive permeability profile compared to other connexins

  • Pore diameter:

    • Gja8 channels have a defined pore size that limits passage based on molecular dimensions

    • The effective pore diameter can be dynamically regulated through conformational changes

    • Studies suggest the unitary conductance of Gja8 channels differs from other connexins, affecting permeability to specific ions

  • N-terminal domain configuration:

    • The N-terminal domain extends into the channel pore

    • The flexibility of the "open turn" after the 10th residue affects channel function

    • Mutations in this region can cause misplacement of the N-terminal domain and alter channel properties

  • Voltage sensing domains:

    • Charged residues in transmembrane domains respond to voltage changes

    • This voltage sensitivity affects channel open probability and therefore permeability

    • Gja8 displays distinctive voltage-gating properties compared to other connexins

Permeability studies have shown that connexin isoforms significantly influence gap junctional permeability to specific molecules. For example, Cx43 channels have a 100- to 300-fold higher selectivity for ATP over Cx32 channels, while Cx32 shows 10-fold higher permeability to adenosine. Although specific permeability data for Gja8 is not provided in the search results, its unique structural features would be expected to create a distinct permeability profile .

How do calcium concentrations and pH affect Gja8 channel activity in experimental systems?

Gja8 channel activity is tightly regulated by both calcium and pH through distinct but potentially interacting mechanisms:

  • Calcium regulation:

    • Increasing intracellular Ca²⁺ concentrations generally lead to gap junction uncoupling

    • The effect of Ca²⁺ on Gja8 is mediated through calmodulin, which binds to Gja8 in a Ca²⁺-dependent manner

    • Studies suggest that upon Ca²⁺ binding, calmodulin may either physically block the channel or induce conformational changes that close the channel

    • The Ca²⁺ concentration required for uncoupling varies between studies, with evidence for synergistic effects between Ca²⁺ and pH

  • pH regulation:

    • Gja8 channels exhibit pH-dependent gating, generally closing in response to acidification

    • The mechanism likely involves protonation of histidine residues and subsequent conformational changes

    • For connexin channels, pH-dependent gating has been associated with the "ball and chain" or "particle-receptor" mechanism, where the C-terminal domain acts as a gating particle that binds to a receptor in the cytoplasmic loop upon protonation

    • Studies with heteromeric channels containing Cx40 and Cx43 show increased sensitivity to pH-dependent gating, suggesting that heteromeric channels containing Gja8 might also show altered pH sensitivity

  • Interaction between Ca²⁺ and pH regulation:

    • Evidence suggests synergistic effects between Ca²⁺ and pH in regulating gap junctions

    • The buffer capacity of commonly used Ca²⁺ buffer EGTA is very sensitive to changes in pH, which may confound experimental results

    • Some studies indicate that pH changes can affect intracellular Ca²⁺ and vice versa, complicating the interpretation of experimental data

Experimental approaches to study these regulatory mechanisms typically include:

  • Patch clamp recordings with controlled intracellular solutions

  • Dye transfer assays under various Ca²⁺ and pH conditions

  • Use of calmodulin inhibitors to dissect Ca²⁺-dependent regulation

  • Site-directed mutagenesis of putative pH and Ca²⁺ sensing residues

What protein-protein interactions regulate Gja8 trafficking, assembly, and degradation?

The life cycle of Gja8 gap junctions is regulated by numerous protein interactions at different stages:

  • Biosynthesis and ER processing:

    • Molecular chaperones (e.g., BiP, calnexin) assist in proper folding

    • Quality control mechanisms ensure only correctly folded Gja8 exits the ER

    • Oligomerization into hexameric connexons typically occurs in the ER or Golgi apparatus

  • Trafficking to the plasma membrane:

    • Microtubule-based transport involves direct interaction with tubulin

    • Motor proteins (e.g., kinesins) mediate vesicular transport of Gja8-containing vesicles

    • Targeting to specific membrane domains may involve interactions with scaffolding proteins

  • Gap junction plaque assembly:

    • ZO-1 (zona occludens-1) scaffolding protein interacts with the C-terminal domain of connexins and regulates plaque size

    • Adherens junction proteins (e.g., α- and β-catenin) may coordinate gap junction positioning

    • Actin cytoskeleton interactions, potentially via the actin-binding protein drebrin, influence gap junction stability

  • Channel regulation and turnover:

    • Calmodulin binding mediates calcium-dependent channel closure

    • Src kinase interactions lead to phosphorylation and altered channel properties

    • Ubiquitin ligases target Gja8 for degradation, marking the end of its lifecycle

  • Internalization and degradation:

    • Clathrin-dependent endocytosis machinery interacts with gap junctions during internalization

    • Autophagy-related proteins may recognize and target internalized gap junctions

    • Lysosomal enzymes ultimately degrade the internalized gap junction structures

Research indicates that gap junctions have a relatively short half-life (typically hours rather than days), requiring continuous biosynthesis and degradation. Studies with connexin mutants lacking the C-terminal domain (such as Cx43K258Stop) show altered spatial organization, increased plaque size, and prolonged half-life, highlighting the importance of protein interactions with the C-terminal domain in regulating gap junction turnover .

How do post-translational modifications affect Gja8 function and what methodologies are used to detect these modifications?

Post-translational modifications (PTMs) of Gja8 serve as key regulatory mechanisms and can be detected through various specialized techniques:

Modification TypeFunctional EffectsDetection MethodsTechnical Considerations
Phosphorylation- Alters channel gating
- Affects protein trafficking
- Modulates protein interactions
- Influences half-life
- Phospho-specific antibodies
- Mass spectrometry
- Phos-tag gels
- ³²P-labeling
- Site-specific phospho-antibodies require validation
- MS requires enrichment strategies
- Consider phosphatase inhibitors during extraction
Ubiquitination- Targets for degradation
- Regulates endocytosis
- Affects protein stability
- Ubiquitin-specific antibodies
- Pull-down with ubiquitin-binding domains
- Mass spectrometry
- Proteasome inhibitors needed to prevent degradation
- Chain-specific antibodies distinguish modification types
S-Nitrosylation- Modulates channel permeability
- Response to oxidative stress
- Biotin switch technique
- Mass spectrometry
- DAF-FM fluorescence
- Highly labile modification
- Requires specialized handling to prevent loss
Glycosylation- Affects trafficking
- Influences hemichannel docking
- Glycosidase treatments
- Lectins
- MS with glycan analysis
- Different glycoforms may have distinct functions
- Some may prevent gap junction formation
SUMOylation- Regulates protein-protein interactions
- Affects intracellular distribution
- SUMO-specific antibodies
- SUMO-binding motif pull-downs
- MS analysis
- Often substoichiometric
- SUMO proteases must be inhibited during extraction

While the search results don't provide specific PTM sites for rat Gja8, research on connexins generally indicates multiple regulatory sites, particularly in the C-terminal domain. For example, studies on Cx43 show that phosphorylation at specific sites can dramatically alter channel function through structural changes that extend beyond the immediate region where modification occurs .

The methodological approaches for studying these modifications typically include:

  • Site-directed mutagenesis:

    • Mutation of potential PTM sites to non-modifiable residues (e.g., S→A for phosphorylation)

    • Creation of phosphomimetic mutations (e.g., S→D or S→E)

    • Functional comparison between wild-type and mutant proteins

  • Mass spectrometry-based approaches:

    • Enrichment of modified peptides prior to analysis

    • Quantitative comparison of modification levels under different conditions

    • Identification of novel modification sites

  • Functional correlation studies:

    • Treatment with inhibitors of specific modification enzymes

    • Temporal correlation between modification and functional changes

    • Use of conformation-specific antibodies that recognize modified forms

The functional significance of PTMs is demonstrated by studies showing that truncation of the C-terminal domain of connexins (where many modifications occur) can dramatically alter channel properties, trafficking, and turnover .

What genetic models are available for studying Gja8 function in vivo, and what phenotypes do they exhibit?

Several genetic models have been developed to study Gja8 function, each providing unique insights into its role:

  • Homozygous knockout models (α8−/−):

    • Phenotype: Significantly smaller lenses with zonular pulverulent nuclear cataracts

    • Functional deficits: Reduced intercellular coupling in lens fibers

    • Additional findings: Despite cataract formation, some lens development proceeds

  • Heterozygous knockout models (α8+/−):

    • Phenotype: Normal development with transparent lenses

    • Significance: Indicates that a single functional allele is sufficient for normal development

  • Double knockout models (Cx α3−/− and α8−/−):

    • Phenotype: Severe nuclear cataracts and microphthalmia (small eyes)

    • Severity: More dramatic than single knockouts, indicating functional cooperation between connexins

  • Knock-in models (KIα3):

    • Design: Genetic replacement of endogenous α8 connexin with wild-type α3 connexin

    • Phenotype: Prevents lens opacification but doesn't rescue the small lens size

    • Significance: Demonstrates partial functional redundancy between connexin subtypes

  • Compound models with GFP transgenes:

    • Design: Gja8 mutations combined with GFP expression

    • Findings: Demonstrated that gap junction communication influences intercellular protein distribution in lens fiber cells

    • Significance: Revealed a novel role for gap junctions in regulating protein distribution

Comparative analysis of these models has revealed several key insights:

ModelLens SizeLens TransparencyIntercellular CouplingProtein Distribution
Wild-typeNormalTransparentNormalUniform GFP distribution
α8−/−Significantly smallerNuclear cataractsReducedDisrupted GFP distribution
α3−/−NormalNuclear cataractsReducedAltered GFP distribution
α8+/−NormalTransparentNear normalNormal GFP distribution
α3−/−/α8−/− (DKO)Severely reducedSevere cataractsMinimalSeverely disrupted
KIα3SmallerTransparentPartially restoredRestored GFP uniformity

These models collectively demonstrate that Gja8 plays critical roles in both lens growth and transparency, with distinct molecular pathways potentially responsible for each function .

How do mutations in Gja8 contribute to cataract formation and other ocular pathologies?

Mutations in Gja8 have been linked to several ocular pathologies through distinct molecular mechanisms:

The pathogenic mechanisms through which Gja8 mutations lead to disease include:

  • Trafficking defects:

    • Mutant proteins fail to reach the plasma membrane

    • Retention in intracellular compartments (ER, Golgi)

    • May trigger unfolded protein response and cellular stress

  • Assembly defects:

    • Inability to form proper hexameric connexons

    • Formation of unstable or improperly structured channels

    • May exert dominant-negative effects on wild-type proteins

  • Gating abnormalities:

    • Altered response to regulatory signals (pH, calcium)

    • Changes in voltage sensitivity

    • Disrupted interaction with regulatory proteins

  • Permeability alterations:

    • Changes in selectivity for crucial metabolites

    • Altered ionic permeability affecting lens electrophysiology

    • Disruption of antioxidant circulation within the lens

Research using knockout mouse models has confirmed the essential role of Gja8 in lens development and transparency. Heterozygous knockout mice develop normally with transparent lenses, while homozygous knockouts show significantly smaller lenses with cataracts, demonstrating the dose-dependent relationship between functional Gja8 and lens health .

What experimental approaches can distinguish between structural and functional effects of Gja8 mutations?

Distinguishing between structural and functional effects of Gja8 mutations requires multiple complementary experimental approaches:

  • Trafficking and localization analysis:

    • Confocal microscopy with fluorescently-tagged Gja8 variants to track cellular localization

    • Surface biotinylation assays to quantify plasma membrane expression

    • Endoglycosidase H sensitivity to determine progression through the secretory pathway

    • Electron microscopy to visualize gap junction plaque formation and structure

  • Assembly and oligomerization assessment:

    • Blue native PAGE to analyze connexon formation

    • Sucrose gradient ultracentrifugation to separate different oligomeric states

    • Cross-linking studies followed by SDS-PAGE to capture protein-protein interactions

    • FRET between differentially labeled connexins to measure proximity within connexons

  • Channel functionality evaluation:

    • Dye transfer assays using gap junction-permeable fluorescent molecules

    • Dual patch-clamp electrophysiology to measure channel conductance properties

    • Metabolite transfer studies to assess permeability to biologically relevant molecules

    • pH and calcium sensitivity analysis to evaluate regulatory responses

  • Structural assessment:

    • Circular dichroism to detect changes in secondary structure

    • Limited proteolysis to probe conformational alterations

    • NMR structural analysis of soluble domains (e.g., C-terminal regions)

    • Molecular dynamics simulations based on available structural information

  • Comparative analyses:

    • Rescue experiments where wild-type protein is co-expressed with mutants

    • Domain swapping between wild-type and mutant proteins to isolate effects

    • Comparison with known trafficking or function-specific mutations as controls

These approaches can be applied systematically to determine whether a mutation primarily affects:

  • Protein folding and stability

  • Trafficking to the plasma membrane

  • Assembly into connexons

  • Docking between connexons of adjacent cells

  • Channel permeability and selectivity

  • Regulation by physiological factors

For example, studies on connexin mutations have revealed that some mutations primarily affect trafficking (resulting in ER retention), while others allow normal trafficking but disrupt channel function or regulation. Understanding these distinctions is crucial for developing targeted therapeutic strategies .

How can researchers use recombinant Gja8 to investigate the molecular determinants of gap junction permeability?

Investigating gap junction permeability using recombinant Gja8 requires sophisticated experimental approaches:

  • Site-directed mutagenesis strategies:

    • Charged residue substitutions in pore-lining regions to alter electrostatic properties

    • Pore size modifications by targeting bulky residues in transmembrane domains

    • Creation of chimeric channels by swapping domains between Gja8 and other connexins with different permeability profiles

    • Systematic alanine scanning of potential selectivity-determining residues

  • Advanced permeability assays:

    • Simultaneous measurement of electrical conductance and dye permeability to distinguish between ion and metabolite permeation

    • FRET-based approaches using molecule-specific sensors to detect transfer of specific metabolites

    • Mass spectrometry analysis of metabolite transfer between connected cell populations

    • Microfluidic platforms for precise control of cellular microenvironments during permeability studies

  • Structural-functional correlation approaches:

    • Cysteine scanning mutagenesis combined with accessibility studies to map pore-lining residues

    • Correlation of molecular dimensions of permeants with their permeability coefficients

    • Computational modeling of pore structure and simulation of molecule passage

    • Cross-linking of introduced cysteines to trap specific conformational states

Research has shown that different connexin isoforms exhibit significant differences in their permeability to biological molecules. For example, Cx43 channels have 100- to 300-fold higher selectivity for ATP compared to Cx32 channels, while glutamate, glutathione, and ADP show 10- to 20-fold preferential permeability through Cx43 channels. Adenosine, conversely, is 10-fold more permeable through Cx32 .

These differences highlight the importance of connexin-specific permeability studies. For Gja8 research, comparing the permeability profiles of wild-type channels to those with strategic mutations can provide insights into the molecular determinants of selectivity. Additionally, the creation of knock-in animals where Gja8 is replaced with other connexins (as has been done with Cx43 and others) can reveal the physiological significance of connexin-specific permeability differences .

What techniques can be employed to study the dynamic regulation of Gja8 in living cells?

Studying the dynamic regulation of Gja8 in living cells requires sophisticated imaging and analytical techniques:

  • Advanced live-cell imaging approaches:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure gap junction plaque dynamics and protein mobility

    • Single particle tracking with quantum dots or photoactivatable fluorescent proteins to follow individual channels

    • Super-resolution microscopy (STORM, PALM, SIM) to visualize plaque structure beyond the diffraction limit

    • TIRF microscopy to selectively visualize events at the plasma membrane

  • Real-time biosensors and reporters:

    • FRET-based sensors for detecting conformational changes in Gja8 during gating

    • pH and calcium indicators to correlate local environmental changes with channel function

    • Split-GFP complementation to monitor protein-protein interactions in real time

    • Bioluminescence resonance energy transfer (BRET) for studying interactions with minimal photobleaching

  • Dynamic regulation monitoring:

    • Optogenetic tools to precisely control cellular signaling pathways that regulate Gja8

    • Fast perfusion systems for rapid changes in extracellular environment

    • Simultaneous electrophysiology and imaging to correlate channel function with structural changes

    • Pulse-chase imaging with photoconvertible fluorescent proteins to track protein turnover

  • Analysis of post-translational modification dynamics:

    • FRET-based sensors for specific post-translational modifications

    • Antibodies that recognize specific modified forms of Gja8

    • Targeted mass spectrometry for quantitative analysis of modification states

    • Correlation of modification state with functional outcomes using patch clamping

Experimental evidence from studies on connexins has shown that gap junction plaques are highly dynamic structures with continuous addition of new channels at the periphery and removal of older channels from central regions. The half-life of connexins is relatively short (typically a few hours), necessitating continuous biosynthesis and degradation for maintenance of functional communication .

Studies using fluorescently tagged connexins have revealed that channel assembly, trafficking, and degradation are tightly regulated processes influenced by numerous factors including phosphorylation state, interaction with partner proteins like ZO-1, and cellular stresses. Similar approaches applied to Gja8 would likely reveal connexin-specific regulatory mechanisms important for lens homeostasis .

How can heteromeric and heterotypic channels containing Gja8 be studied to understand connexin compatibility and functional diversity?

Investigating heteromeric (mixed connexins within one connexon) and heterotypic (different connexons in opposing cells) channels containing Gja8 requires specialized experimental designs:

  • Controlled expression systems:

    • Dual or triple transfection approaches with differentially tagged connexins

    • Inducible expression systems to control relative expression levels

    • Cell fusion techniques to create heterotypic interfaces

    • CRISPR-Cas9 modification of endogenous connexins combined with exogenous expression

  • Isolation and characterization of specific channel types:

    • Affinity purification using tags on specific connexin subtypes

    • Single-channel recording to identify distinct conductance signatures

    • Dye selectivity profiling to characterize unique permeability properties

    • Connexin-specific antibodies for immunoprecipitation of particular channel populations

  • Functional analysis methods:

    • Electrophysiological characterization of voltage-gating properties specific to heteromeric/heterotypic channels

    • pH and calcium sensitivity testing to identify emergent regulatory properties

    • Metabolite permeability assays to detect altered selectivity profiles

    • Pharmacological sensitivity profiling using connexin-selective modulators

  • Structural investigation approaches:

    • FRET between differentially labeled connexins to confirm co-assembly

    • Proximity ligation assays to detect closely associated different connexin types

    • Atomic force microscopy to visualize and distinguish channel subtypes

    • Mass spectrometry of purified gap junctions to determine stoichiometry

Research on heteromeric and heterotypic channels has provided several important insights:

  • In the heart, Cx40 and Cx43 are co-expressed and likely form heteromeric channels. Studies show that these heteromeric channels exhibit altered sensitivity to pH-dependent gating compared to homomeric channels .

  • Molecular interactions between connexins in heteromeric channels have been demonstrated, such as the C-terminal domains of Cx40 and Cx43 interacting with each other and with each other's cytoplasmic loops .

  • Heterotypic channels composed of connexins with opposite gating polarity (such as Cx26 and Cx32) show asymmetric voltage gating, closing only at one polarity .

  • The relative proportion of heteromeric versus homomeric channels depends on the probability of heteromeric oligomerization, which varies between connexin combinations .

For Gja8 specifically, studying its compatibility with other lens-expressed connexins (such as Cx46) could provide insights into the functional diversity of gap junctions in lens tissue and how this contributes to lens homeostasis and transparency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.