Recombinant Rat Gap junction beta-2 protein (Gjb2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Gjb2; Cxn-26; Gap junction beta-2 protein; Connexin-26; Cx26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEE IKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDC FISRPTEKTVFTVFMISVSGICILLNITELCYLFIRYCSGKSKRPV
Uniprot No.

Target Background

Function
Connexin 26 (Cx26) is a structural component of gap junctions. Gap junctions are channels composed of twelve connexin subunits (dodecameric) that directly connect the cytoplasm of adjacent cells. These channels form when two hexameric hemichannels, one from each cell membrane, dock together. Small molecules and ions pass between cells through the central pore of the gap junction.
Gene References Into Functions
  1. Chronic prenatal hypoxia induces hearing impairment, potentially due to Cx26 promoter hypermethylation and reduced expression. PMID: 29207085
  2. Reduced Cx26 expression and promoter hypermethylation in the inner ear of aged rats may contribute to presbycusis. PMID: 25159847
  3. Studies on the surface topography of Cx26 hemichannels. PMID: 25365227
  4. Increased connexin 26 protein and mRNA expression in the cochlear lateral wall after gentamicin injection. PMID: 22896926
  5. Changes in Cx43 expression after neural stem cell engraftment in striatal tissue. PMID: 20654614
  6. The T135 and P87 residues are crucial for Cx26 oligomer stability and gap junction gating. PMID: 20441744
  7. Post-translational modifications (PTMs) of Cx26 are key to understanding how alterations in its biogenesis and function affect auditory function and skin disorders. PMID: 19775242
  8. Mechanical stress in urothelial cells activates JNK, potentially via regulated IB1/JIP-1 expression and AP-1-mediated regulation of Cx26. PMID: 12064607
  9. Differential connexin expression in rat gray matter: Cx26, Cx30, and Cx43 in astrocytes; Cx32 in oligodendrocytes; and Cx36 in neurons. PMID: 12064610
  10. Identification of a novel Cx26 point mutation (439 G->A) linked to autosomal recessive sensorineural hearing loss. PMID: 14676473
  11. Estrogen and ERα induce endometrial Cx26 and Cx43 expression during preimplantation, shifting to an estrogen receptor-independent pathway during implantation and decidualization. PMID: 15028626
  12. Cx26 forms gap junctions but not heterotrimeric channels in co-expressing cells. PMID: 15128867
  13. Aberrant Cx26 methylation may be involved in N-nitrosobis(2-hydroxypropyl)amine-induced lung adenocarcinomas in rats. PMID: 16637067
  14. Cx43 and Cx26 co-regulate epidermal differentiation from basal keratinocytes, with a lesser role in established epidermis maintenance. PMID: 17693411
  15. Cx26 and Cx43 are expressed at radial fiber-migrating neuron contact points; downregulation impairs neuronal migration to the cortical plate. PMID: 17713529
  16. Increased CX26 expression is associated with keratinocyte differentiation. PMID: 19194037
Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Liver, kidney, intestine, lung, spleen, stomach, testis and brain, but not heart and adult skeletal muscle.

Q&A

What is the molecular structure of rat Gjb2 and how does it form functional channels?

Rat Gjb2 encodes the connexin 26 protein, a member of the connexin protein family. These proteins assemble into hexameric structures called connexons that form channels between adjoining cells. The gap junctions created by connexin 26 permit the transport of potassium ions and certain small molecules between cells . Each connexon or hemichannel consists of six connexin subunits, and when two connexons from adjacent cells dock together, they form a complete gap junction channel. The specific arrangement of these subunits determines channel properties including conductance, selectivity, and gating mechanisms .

What is the functional role of Gjb2 in hearing physiology?

Connexin 26 is essential for normal hearing function, particularly in the cochlea. Research indicates that Gjb2 serves two primary functions in the inner ear:

  • Ion homeostasis maintenance: Connexin 26 channels help maintain the proper level of potassium ions in the inner ear, which is critical for the conversion of sound waves to electrical nerve impulses .

  • Cellular maturation: Evidence suggests that connexin 26 is required for the proper development and maturation of certain cells in the cochlea .

The absence or dysfunction of these gap junctions disrupts the recycling of potassium ions necessary for sound transduction, leading to hearing impairment.

What expression systems are most effective for producing functional recombinant rat Gjb2?

The baculovirus expression system using insect cells has proven highly effective for producing functional recombinant rat Gjb2 protein. In this approach, rat beta 2 cDNA is inserted into a baculovirus vector, which is then used to infect insect cells . This system offers several advantages:

  • High expression levels of recombinant protein

  • Proper protein folding and assembly into functional connexons

  • Ability to isolate connexons that can be reconstituted into planar lipid bilayers for functional studies

This heterologous expression system has successfully generated functional Gjb2 connexons that maintain native-like channel properties, providing a foundation for identifying and characterizing endogenous beta 2 connexon channels in rat tissues .

What are the electrophysiological properties of recombinant rat Gjb2 channels?

Recombinant rat Gjb2 channels demonstrate distinctive electrophysiological characteristics when reconstituted into experimental systems. Key properties include:

Conductance StateValue (in 200 mM KCl)Frequency
Primary conductance35-45 pSMost common
Secondary conductance60 pSLess frequent
Tertiary conductance90-110 pSLeast common

These channels maintain activity at voltages up to 150 mV, demonstrating their robust functional properties. The presence of multiple conductance states suggests heterogeneity within connexon populations, even when composed of the same connexin type . These electrophysiological signatures provide valuable benchmarks for identifying native Gjb2 channels in tissue preparations.

How do different types of Gjb2 mutations affect protein function?

Mutations in the Gjb2 gene can disrupt connexin 26 function through multiple mechanisms, with varying consequences for cellular physiology:

  • Trafficking defects: Some mutations impair protein transport to the plasma membrane, preventing formation of functional gap junctions.

  • Channel conductance alterations: Mutations can modify the biophysical properties of channels, affecting their conductance or permeability.

  • Hemichannel dysfunction: Certain mutations cause abnormal opening of unpaired connexons, potentially leading to cell damage through disruption of ionic homeostasis.

  • Dominant-negative effects: Mutant proteins may interfere with the function of wild-type connexins, including trans-dominant effects on other connexin types .

The specific consequences depend on the mutation location within the protein structure and whether it affects critical domains for channel formation, docking, or permeability.

What methodologies are most effective for analyzing novel Gjb2 missense variants?

Analysis of novel Gjb2 missense variants requires a multi-faceted approach combining computational prediction, molecular biology, and functional assays:

  • In silico analysis: Computational tools to predict variant pathogenicity based on evolutionary conservation and biochemical properties.

  • Recombinant expression: Generation of mutant constructs for expression in appropriate cellular systems.

  • Trafficking analysis: Immunofluorescence microscopy to assess protein localization and gap junction plaque formation.

  • Functional assessments:

    • Dye transfer assays to evaluate gap junction communication

    • Electrophysiological recordings to measure channel conductance

    • Hemichannel activity assays to detect abnormal function

  • Deep mutational scanning (DMS): This emerging high-throughput approach can systematically assess the functional impact of all possible missense variants simultaneously, creating a comprehensive map of variant effects on trafficking, hemichannel activity, gap junction function, and cell viability .

How do researchers distinguish between pathogenic and benign Gjb2 variants?

Differentiating pathogenic from benign variants remains challenging, particularly for novel missense variations. Current best practices include:

  • Functional validation through experimental systems demonstrating impaired channel properties or trafficking defects.

  • Genetic evidence including segregation with disease phenotype in families and absence/rarity in control populations.

  • Domain-specific analysis, as mutations in critical regions (transmembrane domains, extracellular loops) are more likely to be pathogenic.

  • Population-specific considerations, as variant pathogenicity may differ across ethnic groups.

Do heterozygous carriers of Gjb2 mutations exhibit subtle hearing phenotypes?

Studies examining hearing function in heterozygous carriers of Gjb2 mutations have yielded contradictory results. Recent research using advanced methodologies reveals:

  • High-frequency hearing loss: After normalizing audiograms for age and sex, heterozygous female carriers of the GJB2 c.35delG mutation showed significantly larger hearing loss at frequencies of 8-16 kHz compared to controls .

  • Sex differences: The hearing deterioration in heterozygous males compared to controls was not statistically significant, suggesting possible sex-specific effects .

  • Normal otoacoustic emissions: Comparisons of Transient Evoked Otoacoustic Emission (TEOAE) responses and Distortion Product Otoacoustic Emission (DPOAE) levels between heterozygotes and controls did not reveal significant differences .

These findings highlight the importance of using extended high-frequency audiometry (8-16 kHz) and proper audiogram normalization techniques to detect subtle hearing deficits that might otherwise be missed with standard clinical assessments.

What methodological approaches are recommended for studying Gjb2 heterozygote phenotypes?

Based on current research, the following methodological approaches are recommended:

  • Extended high-frequency audiometry (up to 16 kHz) to capture subtle deficits beyond the standard clinical frequency range .

  • Age and sex normalization of audiometric data to control for these variables that significantly impact hearing thresholds .

  • Multiple complementary testing methods:

    • Pure-tone audiometry for subjective hearing thresholds

    • Otoacoustic emissions (OAEs) to assess cochlear function

    • Auditory brainstem responses for objective auditory pathway assessment

  • Adequate sample sizes with appropriate control groups matched for age, sex, and noise exposure history.

  • Genetic confirmation of heterozygous status using standardized DNA sequencing protocols with reference sequence comparisons (Genbank Accession Numbers M86849, U43932, and/or XM_007169) .

  • Consistent nucleotide numbering conventions, starting with the A of the ATG start codon in exon 2 as position number +1 .

How should researchers interpret contradictory findings in heterozygote studies?

When facing contradictory results regarding Gjb2 heterozygote phenotypes, researchers should consider:

  • Methodological differences: Studies limited to standard audiometric frequencies (≤8 kHz) may miss subtle deficits detectable only at extended high frequencies (8-16 kHz) .

  • Sample heterogeneity: Small cohort sizes, variable age distributions, and different genetic backgrounds can influence outcomes.

  • Genetic complexity: Modifier genes or environmental factors may influence the phenotypic expression of heterozygous mutations.

  • Sex-specific effects: As demonstrated by differential findings between male and female heterozygotes , sex-specific analyses should be conducted.

  • Statistical approaches: Appropriate statistical methods with corrections for multiple comparisons are essential, especially when analyzing small effect sizes.

Researchers should explicitly address these factors when designing studies and interpreting results, and should consider integrating data across multiple studies through meta-analysis when appropriate.

What techniques provide the most reliable data for Gjb2 channel function assessment?

Multiple complementary techniques provide robust characterization of Gjb2 channel function:

  • Planar lipid bilayer reconstitution: This approach allows direct measurement of single channel properties of isolated connexons under controlled conditions. In this system, recombinant rat beta 2 connexons demonstrated unitary conductance of 35-45 pS in 200 mM KCl, with higher conductance states (60 pS and 90-110 pS) also observed .

  • Dye transfer assays: These assess gap junction communication capacity through the movement of fluorescent tracers between connected cells.

  • Dual whole-cell patch clamp: This technique measures electrical coupling between cell pairs expressing connexin 26, providing direct assessment of junctional conductance.

  • Hemichannel activity assays: These evaluate the function of unpaired connexons through dye uptake or ATP release measurements.

Each method provides unique insights, and combining multiple techniques strengthens the reliability of functional characterizations.

How does the molecular structure of Gjb2 correlate with channel function?

The structure-function relationship of Gjb2 reveals how specific domains contribute to channel properties:

  • Transmembrane domains: These regions form the channel pore and influence conductance properties. Mutations in these domains frequently alter channel permeability or gating.

  • Extracellular loops: These domains are critical for docking between connexons from adjacent cells. Mutations here often disrupt gap junction formation.

  • Cytoplasmic domains: These regions regulate channel gating and interact with cytoskeletal and regulatory proteins.

Understanding these structure-function relationships is essential for interpreting how specific mutations might affect channel function and contribute to disease phenotypes.

What emerging technologies show promise for comprehensive functional assessment of Gjb2 variants?

Deep mutational scanning (DMS) represents a revolutionary approach for Gjb2 variant analysis. This technique creates a library of all possible 4294 missense variants and subjects them to selection systems evaluating:

  • Connexin trafficking efficiency

  • Hemichannel activity

  • Gap junction communication function

  • Cell viability impacts

  • Dominant-negative or trans-dominant effects on co-expressed connexins

This comprehensive approach will elucidate molecular mechanisms by which different Gjb2 missense variants cause diverse clinical hearing loss phenotypes, advancing genetic testing applications in hearing loss prevention and management .

What research gaps remain in understanding Gjb2 function and dysfunction?

Despite significant advances, important knowledge gaps persist:

  • Tissue-specific functions: How connexin 26 function varies across different tissues expressing the protein, including skin and cochlea.

  • Compensatory mechanisms: The extent to which other connexins may compensate for Gjb2 dysfunction in heterozygotes.

  • Age-related changes: How Gjb2 function alters with aging and contributes to age-related hearing loss.

  • Therapeutic targets: Identifying potential interventions to rescue function of specific mutant forms of connexin 26.

  • Integration with systems biology: Understanding how Gjb2 function interfaces with broader cellular networks and signaling pathways.

Addressing these questions will require integrated approaches combining genetics, cell biology, physiology, and translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.