Recombinant Rat Gap junction beta-3 protein (Gjb3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat Gjb3 is synthesized using prokaryotic expression systems:

  • Host System: Escherichia coli (E. coli)

  • Purification: Affinity chromatography via His/GST tags ensures >95% purity .

  • Reconstitution: Lyophilized protein is reconstituted in PBS (pH 7.4) to concentrations of 0.1–1.0 mg/mL .

  • Storage: Stable at -80°C for long-term storage; avoid repeated freeze-thaw cycles .

Applications in Research

Recombinant Rat Gjb3 is widely utilized in:

Antibody Development

  • Serves as an immunogen for polyclonal antibody production (e.g., Abbexa OACD02881, Boster Bio A03199) .

  • Validated in Western blot (WB), immunohistochemistry (IHC), and immunoprecipitation (IP) .

Functional Studies

  • Used to investigate gap junction assembly and trafficking pathways (e.g., calcium regulation, membrane transport) .

  • Enables analysis of disease-linked mutations (e.g., erythrokeratodermia variabilis, nonsyndromic hearing loss) .

Pathological Implications

  • Skin Disorders: Mutations in GJB3 disrupt epidermal differentiation, leading to hyperkeratosis and erythema . Recombinant Gjb3 aids in modeling ER stress and cell death mechanisms .

  • Hearing Loss: Dominant GJB3 mutations impair ion transport in the inner ear, contributing to sensorineural deafness .

Mechanistic Insights

  • Channel Dysfunction: Abnormal Gjb3 forms constitutively active hemichannels, promoting necrotic cell death .

  • Interactions: Competes with other connexins (e.g., GJB2) to disrupt gap junction networks .

Future Directions

  • Therapeutic Screening: Recombinant Gjb3 could enable high-throughput drug testing for connexin-related disorders.

  • Structural Biology: Cryo-EM studies using recombinant protein may resolve channel gating mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are sent with standard blue ice packs. For dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Gjb3; Cxn-31; Gap junction beta-3 protein; Connexin-31; Cx31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Gjb3
Target Protein Sequence
MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTRQPGC TNVCYDNFFPISNIRLWALQLIFVTCPSMLVILHVAYREERERKHRQKHGEHCAKLYSHP GKKHGGLWWTYLFSLIFKLIIELVFLYVLHTLWHGFTMPRLVQCASVVPCPNTVDCYIAR PTEKKVFTYFMVGASAVCIILTICEICYLIFHRIMRGLSKDKSTKSISSPKSSSRASTCR CHHKLLESGDLEAVPADDKLQASAPSLTPI
Uniprot No.

Target Background

Function
Gap junctions are comprised of clusters of closely packed pairs of transmembrane channels, known as connexons. These connexons facilitate the diffusion of low molecular weight materials between adjacent cells.
Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the basic structure and function of rat Gjb3 protein?

Rat Gap junction beta-3 protein (Gjb3), also known as Connexin-31 (Cx31), is a transmembrane protein with a molecular weight of approximately 30.8 kDa. Functionally, Gjb3 forms part of gap junctions, which are specialized intercellular connections that directly connect the cytoplasm of two adjacent cells. Gap junctions consist of closely packed clusters of transmembrane channels called connexons, which allow the diffusion of small molecular weight materials between neighboring cells. This direct intercellular coupling facilitates both electrical and chemical communication between cells . Structurally, the full-length rat Gjb3 protein consists of 270 amino acids, with several functional domains including transmembrane regions, extracellular loops, and cytoplasmic domains that contribute to channel formation and regulation.

How does recombinant rat Gjb3 differ from native rat Gjb3?

Recombinant rat Gjb3 is produced through genetic engineering techniques in expression systems such as E. coli, whereas native Gjb3 is naturally expressed in rat tissues. The key differences include:

  • Tag additions: Recombinant Gjb3 typically contains affinity tags such as His-tag or GST-tag to facilitate purification and detection, which are absent in native protein .

  • Post-translational modifications: Depending on the expression system used, recombinant Gjb3 may lack some post-translational modifications present in the native protein, particularly when expressed in prokaryotic systems like E. coli.

  • Purity levels: Recombinant proteins can achieve high purity levels (>90-95%) through affinity purification techniques, allowing for more controlled experimental conditions .

  • Functional variations: Recombinant Gjb3 produced in heterologous systems may exhibit subtle functional differences compared to native protein due to differences in folding environment or absence of tissue-specific chaperones.

For research applications requiring native-like functionality, mammalian expression systems (like HEK-293 cells) or cell-free protein synthesis may provide recombinant Gjb3 with properties more closely resembling the native protein .

What expression systems are most effective for producing functional recombinant rat Gjb3?

The effectiveness of expression systems for producing functional rat Gjb3 varies based on research requirements:

Expression SystemPurity LevelAdvantagesLimitationsBest Applications
E. coli>95%High yield, cost-effective, suitable for structural studiesMay lack post-translational modifications, potential inclusion body formationWestern blot standards, immunization, structural studies
HEK-293 Cells>90%Mammalian post-translational modifications, better foldingLower yield, more expensive, longer production timeFunctional studies, cell-based assays
Cell-free Protein Synthesis70-80%Rapid production, avoids cell toxicity issuesModerate yield, relatively expensiveDifficult-to-express proteins, rapid screening
Wheat GermVariableGood for difficult mammalian proteinsModerate yieldAlternative when other systems fail

For functional studies of gap junction activity, mammalian expression systems like HEK-293 cells are generally preferred as they provide the appropriate cellular machinery for proper folding and post-translational modifications essential for channel function .

How is Gjb3 expression regulated in normal tissues versus disease states?

Gjb3 expression exhibits distinct patterns in normal tissues compared to disease states, particularly in cancer:

In normal tissues, Gjb3 expression is tightly regulated through various mechanisms:

  • Transcriptional regulation through tissue-specific promoters

  • Epigenetic control including DNA methylation

  • Post-transcriptional regulation via microRNAs

In disease states, particularly cancer, Gjb3 expression shows significant dysregulation:

  • Overexpression: Gjb3 is notably overexpressed in colorectal adenocarcinoma (COAD) and lung adenocarcinoma (LUAD), correlating significantly with poor patient survival outcomes .

  • Epigenetic alterations: Differential methylation patterns of the Gjb3 gene are observed in cancer tissues compared to normal tissues .

  • Response to therapy: In breast cancer cells, Gjb3 expression increases in response to demethylating agents like DAC (2.5μM), suggesting epigenetic silencing in normal conditions and potential roles in therapy resistance .

This differential expression pattern makes Gjb3 both a potential biomarker and therapeutic target, particularly in cancer contexts where its overexpression correlates with more aggressive disease.

What epigenetic mechanisms regulate Gjb3 expression, and how can researchers manipulate these experimentally?

Several epigenetic mechanisms regulate Gjb3 expression that researchers can experimentally manipulate:

  • DNA Methylation: Gjb3 expression is significantly influenced by methylation status.

    • Experimental approach: Treatment with demethylating agents such as 5-aza-2'-deoxycytidine (DAC) at 2.5μM concentration has been shown to increase Gjb3 RNA levels in breast cancer cell lines like MDA-MB231 .

    • Methodology: Researchers can perform methylation-specific PCR or bisulfite sequencing to analyze the methylation status of Gjb3 promoter regions before and after treatment.

  • Histone modifications:

    • Experimental approach: Chromatin immunoprecipitation (ChIP) assays can be used to analyze histone modifications at the Gjb3 promoter.

    • Treatment with histone deacetylase inhibitors can help determine if histone acetylation affects Gjb3 expression.

  • Combined approaches:

    • For comprehensive analysis, researchers can integrate DNA methylation analysis with histone modification studies and expression data through techniques like ChIP-seq combined with RNA-seq.

    • Experimental design should include proper controls, such as untreated cells and cells treated with vehicle only.

Research has shown that cells with methylation-suppressed Gjb3 respond differently to demethylating therapy depending on whether Gjb3 is subsequently knocked down, suggesting complex regulatory mechanisms that can be targeted experimentally .

What are the most effective methods for analyzing Gjb3-mediated gap junctional coupling in live cells?

Several state-of-the-art methods can be employed to analyze Gjb3-mediated gap junctional coupling in live cells:

  • PARIS (Pairing Actuators and Receivers to Optically Isolate Gap Junctions):

    • This fully genetically encoded tool enables cell-specific measurement of gap junctional coupling with ~10 second temporal resolution and sub-cellular spatial resolution.

    • PARIS works by expressing an optically controlled actuator in one cell to generate an electrochemical gradient and a fluorescent receiver in an adjacent cell to detect molecule movement across gap junctions.

    • Advantages: Non-invasive, cell-type specific, allows repeated measurements of the same gap junctions to assess dynamics and plasticity .

  • Dye Transfer Assays:

    • Traditional approaches using gap junction-permeable fluorescent dyes.

    • Methodology: Load donor cells with dye, co-culture with recipient cells, and monitor dye transfer.

    • Limitation: Lacks cell-type specificity and may be invasive, making it less suitable for complex tissues.

  • Electrophysiological Paired Recordings:

    • Direct measurement of electrical coupling between adjacent cells.

    • Provides high temporal resolution but is invasive and technically challenging.

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Bleach fluorescent molecules in one cell and monitor recovery via gap junction diffusion.

    • Less invasive than microinjection but still requires loading of exogenous dyes.

The PARIS method represents a significant advancement by overcoming limitations of traditional approaches, offering both specificity and high spatiotemporal resolution ideal for studying Gjb3 function in complex tissues like the nervous system .

How can researchers effectively knockdown Gjb3 to study its function, and what phenotypes should be monitored?

Researchers can effectively knockdown Gjb3 using several approaches, each with specific considerations for experimental design:

Knockdown Methods:

  • shRNA-mediated knockdown:

    • Highly effective for sustained knockdown with approximately 85% reduction in Gjb3 expression at both mRNA and protein levels .

    • Implementation: Lentiviral delivery of shGjb3 constructs provides stable integration and long-term knockdown.

    • Validation: Always confirm knockdown efficiency via real-time PCR and immunoblotting before phenotypic analysis .

  • siRNA-mediated knockdown:

    • Suitable for transient knockdown experiments.

    • Less long-lasting than shRNA but may have fewer off-target effects.

  • CRISPR-Cas9 gene editing:

    • For complete knockout studies rather than knockdown.

    • Provides permanent genetic modification.

Key Phenotypes to Monitor:

PhenotypeMeasurement MethodExpected Outcome in Gjb3-Deficient CellsReference
Cell ProliferationCell counting, MTT/MTS assaysDecreased proliferation rate
Colony FormationColony formation assayReduced colony formation capability
Cell MigrationWound healing/scratch assaySignificantly slower migration
Cell DeathImaging analysis, apoptosis assaysIncreased cell death
Stress ResponseWestern blot for p-eIF2α and ATF4Increased phosphorylation of eIF2α and ATF4 levels
AutophagyWestern blot for autophagy markersActivation of autophagy pathways
Metastatic PotentialIn vivo bioluminescence imaging~40% reduction in metastatic burden (in PDAC models)
Survival (in animal models)Kaplan-Meier analysisExtended median survival (31 days to 41 days in PDAC models)

For cancer studies, researchers should particularly monitor the activation of cellular stress response pathways, as Gjb3 knockdown has been shown to activate starvation and autophagy pathways through the GCN2-eIF2α-ATF4 signaling axis .

How does Gjb3 contribute to cancer progression and metastasis?

Gjb3 contributes to cancer progression and metastasis through several interconnected mechanisms:

  • Metabolic Support:

    • Gjb3 plays a crucial role in cystine uptake, particularly in cells with low SLC7A11 expression .

    • Metabolic profiling reveals significant decreases in cystine levels in Gjb3-deficient cells.

    • This metabolic function supports cancer cell survival under nutrient-limited conditions.

  • Stress Response Modulation:

    • Gjb3 knockdown induces cellular stress response characterized by:

      • Activation of starvation response pathways

      • Increased phosphorylation of eIF2α

      • Activation of the GCN2-eIF2α-ATF4 signaling axis

      • Subsequent autophagy induction

    • This suggests Gjb3 normally suppresses these stress pathways, allowing cancer cells to evade stress-induced death.

  • Direct Promotion of Metastasis:

    • In pancreatic ductal adenocarcinoma (PDAC), Gjb3 significantly enhances liver metastasis.

    • Knockdown studies show:

      • ~40% reduction in liver metastasis burden

      • 30% decrease in metastatic liver weight

      • Suppressed growth of tumor cells in liver metastases (confirmed by PCNA IHC staining)

      • Extended median survival from 31 to 41 days in animal models

  • Therapeutic Resistance:

    • Gjb3 expression may act as a resistance mechanism against demethylating agents like DAC.

    • In breast cancer cells treated with DAC, Gjb3 knockdown significantly decreases cell growth compared to controls .

These findings collectively establish Gjb3 as a multifunctional promoter of cancer progression affecting metabolic support, stress response modulation, metastatic potential, and therapeutic resistance pathways.

What are the molecular mechanisms through which Gjb3 regulates cellular stress responses?

Gjb3 regulates cellular stress responses through multiple molecular mechanisms:

  • Regulation of the Integrated Stress Response (ISR) Pathway:

    • Gjb3 knockdown activates the GCN2-eIF2α-ATF4 signaling axis, a major branch of the ISR .

    • Mechanistically, this involves:

      • Increased phosphorylation of eIF2α, the central mediator of ISR

      • Elevated ATF4 levels, the downstream transcription factor that regulates stress response genes

      • This pathway is typically activated when cells encounter amino acid starvation or other stressors

  • Modulation of Amino Acid Transport and Metabolism:

    • Gene ontology analysis of cells following Gjb3 silencing revealed upregulation of genes associated with:

      • Response to starvation

      • Amino acid transport processes

      • Amino acid synthesis pathways

    • Gjb3 appears to play a specific role in cystine uptake, with metabolic profiling showing decreased cystine levels in Gjb3-deficient cells

  • Autophagy Regulation:

    • Gjb3 knockdown induces autophagy, a cellular process activated during nutrient limitation

    • Sustained autophagy in Gjb3-deficient cells ultimately leads to apoptosis-mediated cell death

    • This suggests Gjb3 normally functions to suppress excessive autophagy

  • Transcriptional Reprogramming:

    • RNA-seq analysis identified 475 upregulated and 801 downregulated genes following Gjb3 knockdown

    • Upregulated genes were predominantly associated with stress-related pathways

    • Downregulated genes were linked to cancer-promoting pathways

These findings indicate that Gjb3 functions as a stress-protective protein in cancer cells, and its removal triggers multiple stress response mechanisms that ultimately compromise cancer cell survival and growth.

How can researchers target Gjb3 therapeutically, and what experimental models best demonstrate efficacy?

Researchers can employ several strategies to target Gjb3 therapeutically, with specific experimental models demonstrating efficacy:

Therapeutic Targeting Strategies:

  • Antibody-Based Targeting:

    • Anti-Gjb3 specific antibodies have shown potential as therapeutic agents for Gjb3-dependent cancers .

    • Mechanism: Antibodies can block Gjb3 function by binding to extracellular domains of the protein, disrupting channel formation or function.

    • Development approach: Researchers can generate monoclonal antibodies against specific epitopes of rat Gjb3, particularly targeting the extracellular loops.

  • RNA Interference Approaches:

    • shRNA-mediated knockdown has demonstrated significant efficacy in preclinical models .

    • Delivery systems: Lentiviral vectors for in vitro studies; lipid nanoparticles or other delivery vehicles for in vivo applications.

    • Target sequence selection is critical for specificity and efficacy.

  • Small Molecule Inhibitors:

    • Gap junction modulators that specifically target Gjb3 channels.

    • Screening approach: High-throughput screening using cells expressing recombinant Gjb3 and functional assays to measure gap junction activity.

Optimal Experimental Models:

Model TypeSpecific ModelKey ReadoutsAdvantagesReference
In vitro cell modelsCancer cell lines with high endogenous Gjb3 expressionCell proliferation, migration, stress response markersControlled conditions, mechanistic studies
Orthotopic metastasis modelsSplenic injection model for liver metastasisBioluminescence imaging, metastatic burdenPhysiologically relevant microenvironment
Patient-derived xenograftsPDX from Gjb3-high tumorsTumor growth, response to combination therapyBetter reflects human tumor heterogeneityInferred
Genetic mouse modelsTissue-specific Gjb3 knockout/knockinTumor initiation, progression, metastasisEvaluates role in specific stages of cancerInferred

The splenic injection model used to study PDAC liver metastasis has proven particularly effective, with Gjb3 knockdown resulting in approximately 40% reduction in metastatic burden and significantly extended survival . For therapeutic efficacy assessment, combining Gjb3 targeting with standard chemotherapies may reveal synergistic effects, particularly in cancers where Gjb3 is overexpressed.

What is the relationship between Gjb3 and other connexin family members in forming functional gap junctions?

The relationship between Gjb3 and other connexin family members in forming functional gap junctions is complex and involves several key aspects:

  • Heteromeric vs. Homomeric Channel Formation:

    • Gjb3 (Connexin-31) can form both homomeric channels (composed of six identical Gjb3 subunits) and heteromeric channels (containing Gjb3 and other connexin subtypes).

    • This diversity in channel composition affects permeability properties, gating sensitivity, and regulatory responses.

    • Researchers investigating channel composition can use co-immunoprecipitation techniques followed by mass spectrometry to identify interacting connexin partners.

  • Compatibility in Heterotypic Channels:

    • Not all connexins are compatible for forming functional heterotypic channels.

    • Compatibility is determined by the structure of the extracellular loops that dock between adjacent cells.

    • Experimental approaches to study compatibility include:

      • Expression of different connexin pairs in communication-deficient cell lines

      • Electrophysiological measurements of gap junctional conductance

      • Dye transfer assays with gap junction-permeable fluorescent tracers

      • The PARIS method for non-invasive assessment of functional coupling

  • Compensatory Mechanisms:

    • Knockdown or knockout of Gjb3 may lead to compensatory upregulation of other connexin family members.

    • This phenomenon complicates interpretation of knockdown studies and may explain variable phenotypes.

    • Comprehensive analysis should include expression profiling of multiple connexin family members following Gjb3 manipulation.

  • Tissue-Specific Partnerships:

    • The predominant connexin partnerships vary by tissue type, reflecting specialized functional requirements.

    • In studying Gjb3 function in a specific tissue context, researchers should first characterize the normal connexin expression profile of that tissue.

The PARIS method represents a significant advancement for studying these complex interactions, as it allows cell-specific assessment of gap junctional coupling with high spatiotemporal resolution in living tissues . This can provide important insights into how Gjb3 functionally interacts with other connexins under physiological or pathological conditions.

What are the optimal storage and handling conditions for recombinant rat Gjb3 protein to maintain functionality?

Optimal storage and handling of recombinant rat Gjb3 protein requires careful attention to several factors to maintain structural integrity and functionality:

Storage Conditions:

ParameterRecommended ConditionRationale
Storage Temperature-80°C for long-term storagePrevents protein degradation and maintains structural integrity
Buffer CompositionManufacturer-specific, typically containing stabilizersBuffer composition is critical for maintaining protein solubility and preventing aggregation
AliquotingSmall single-use aliquotsMinimizes freeze-thaw cycles
Freeze-Thaw CyclesAvoid repeated freeze-thawEach cycle can reduce functionality; repeated cycles should be strictly avoided

Handling Guidelines:

  • Thawing Protocol:

    • Thaw recombinant Gjb3 rapidly at room temperature or in a 37°C water bath

    • Once thawed, keep on ice while working

    • Return to -80°C storage immediately after use

  • Working Temperature:

    • Maintain at 4°C during experimental procedures

    • For functional assays, equilibrate to experimental temperature immediately before use

  • Stability Considerations:

    • Gjb3 has multiple transmembrane domains and may be prone to aggregation

    • Consider adding reducing agents if the protein contains exposed cysteine residues

    • For experiments requiring extended incubation times, verify protein stability under experimental conditions

  • Quality Control:

    • Before using in critical experiments, verify protein integrity by SDS-PAGE

    • For functional studies, validate activity using established assays

Manufacturers typically recommend storing recombinant Gjb3 at -80°C with an expected shelf life of approximately 12 months when properly stored . For experiments requiring preserved gap junction channel functionality, extra care should be taken to maintain the native conformation of the protein.

How can researchers troubleshoot issues with recombinant Gjb3 expression and purification?

Researchers may encounter several challenges when expressing and purifying recombinant Gjb3. Here's a comprehensive troubleshooting guide:

1. Low Expression Yield:

ProblemPossible CausesSolutions
Poor expression in E. coliMembrane protein toxicity, codon bias- Use C41/C43 E. coli strains designed for membrane proteins
- Optimize codon usage for E. coli
- Reduce induction temperature (16-20°C)
- Try fusion tags (MBP, SUMO) to improve solubility
Low yield in mammalian cellsCytotoxicity, poor transfection efficiency- Use inducible expression systems
- Optimize transfection conditions
- Consider stable cell line generation
- Try HEK-293 cells which have shown success with Gjb3

2. Protein Solubility Issues:

ProblemPossible CausesSolutions
Inclusion body formationImproper folding, overexpression- Reduce induction temperature and IPTG concentration
- Try cell-free protein synthesis which has shown 70-80% purity for Gjb3
- Use mild detergents for extraction (DDM, LMNG)
Aggregation during purificationExposure of hydrophobic regions- Include stabilizing agents (glycerol, specific lipids)
- Optimize detergent concentration
- Consider amphipol or nanodisc reconstitution

3. Purification Challenges:

ProblemPossible CausesSolutions
Poor binding to affinity resinsTag inaccessibility, improper buffer conditions- Confirm tag is not buried in protein structure
- Optimize imidazole concentration for His-tagged Gjb3
- Try different tag positions (N vs C-terminal)
Contaminants after purificationNon-specific binding- Include additional purification steps (ion exchange, size exclusion)
- Optimize wash conditions
- For His-tagged Gjb3, include low imidazole in wash buffers

4. Activity Assessment:

ProblemPossible CausesSolutions
Lack of functional activityDenaturation, improper reconstitution- Verify protein integrity by circular dichroism
- Ensure proper detergent removal during reconstitution
- Consider alternative functional assays (e.g., PARIS method)

5. Validation Methods:

For quality control, combine multiple analytical techniques:

  • SDS-PAGE and Western blot to confirm identity and integrity

  • Size exclusion chromatography to assess homogeneity

  • Mass spectrometry for accurate mass determination

  • Functional assays specific to gap junction proteins

When working with recombinant rat Gjb3, researchers have achieved >90% purity using HEK-293 cell expression systems and >70-80% purity with cell-free protein synthesis approaches, as determined by SDS-PAGE, Western Blot, and analytical SEC (HPLC) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.