Recombinant Rat Gap junction gamma-2 protein (Gjc2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Gap Junction Gamma-2 Protein (Gjc2)

Recombinant Rat Gap Junction Gamma-2 Protein (Gjc2) is a protein produced through recombinant DNA technology, derived from the rat gene Gjc2. This protein is a member of the connexin family, specifically known as connexin-47 (Cx47), and plays a crucial role in forming gap junctions between cells. Gap junctions are channels that allow the passage of small molecules, ions, and nutrients between adjacent cells, facilitating intercellular communication and coordination.

Structure and Function

Gap junction proteins, including Gjc2, consist of four transmembrane domains, two extracellular domains, and three cytoplasmic domains. These proteins assemble into connexons, which form the gap junction channels. In the rat, Gjc2 is involved in various physiological processes, including myelination in the central and peripheral nervous systems. Myelination is essential for the rapid transmission of nerve impulses.

DomainDescription
TransmembraneFour domains spanning the cell membrane.
ExtracellularTwo domains involved in interactions with other cells.
CytoplasmicThree domains involved in intracellular signaling.

Production and Applications

Recombinant Rat Gap Junction Gamma-2 Protein (Gjc2) is produced in various systems, such as bacterial (e.g., E. coli), mammalian cells (e.g., HEK293), or other cell lines. This protein is used in research for studying gap junction function, myelination processes, and related diseases. It is also a target for developing diagnostic tools and therapeutic interventions.

Production SystemAdvantages
E. coliHigh yield, cost-effective.
Mammalian CellsProper folding and post-translational modifications.

Research Findings

Research on Gjc2 has highlighted its role in neurological diseases. Defects in the human homolog of Gjc2 are associated with Pelizaeus-Merzbacher-like disease, a condition characterized by impaired myelination in the central nervous system. Studies using rat models have provided insights into the mechanisms of myelination and the impact of Gjc2 mutations on neurological function.

DiseaseAssociation with Gjc2
Pelizaeus-Merzbacher-like DiseaseImpaired myelination due to Gjc2 mutations.
Hypomyelinating LeukodystrophyLinked to defects in Gjc2 function.

Recombinant Rat Gap Junction Gamma-2 Protein (Gjc2) is a valuable tool for studying gap junction biology and its implications in neurological diseases. Its role in myelination and intercellular communication makes it a significant target for both basic research and therapeutic development. Further studies on Gjc2 will continue to elucidate its functions and potential applications in medicine.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gjc2; Gja12; Gap junction gamma-2 protein; Connexin-47; Cx47; Gap junction alpha-12 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Gjc2
Target Protein Sequence
MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGESIYSDEQSKFTCNTRQ PGCDNVCYDAFAPLSHVRFWVFQIVVISTPSVMYLGYAVHRLARASEQERRRALRRRPGP RRLPRAQLPPPPPGWPDTTDLGEAEPILALEEDEDEEPGAPEGPGEDTEEERTEDVAAKG GGGDGKTVVTPGPAGQHDGRRRIQREGLMRVYVAQLVVRAAFEVAFLVGQYLLYGFEVPP FFACSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGSAQDAVRGR RGASAAGPGPAPRPPPCAFPAAAAGLACPPDYSLVVRAAERARAHDQNLANLALQALRDG AAVAAVSADRDSPPCSGLNATSRGPPRAGGPASGTGSATSGGTVGEQGRSGAQEQLATKP RVGSEKGSTGSRDGKATVWI
Uniprot No.

Target Background

Function

Gap junctions are composed of clusters of closely apposed transmembrane channels, known as connexons. These connexons facilitate the diffusion of low-molecular-weight materials between adjacent cells. Cx47 may play a role in the myelination of both the central and peripheral nervous systems.

Gene References Into Functions
  1. This study indicates a key role for Cx47 in myelination. PMID: 20578039
Database Links
Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Mainly expressed by oligodendrocytes in the central nervous system. Expressed in optic nerve (at protein level).

Q&A

What is rat Gjc2 and how does it compare to human GJC2?

Rat Gjc2, like its human counterpart GJC2, belongs to the connexin family of gap junction proteins. Both proteins function as integral membrane proteins that form channels (gap junctions) between adjacent cells. Gap junction proteins typically comprise 4 transmembrane domains, 2 extracellular domains, and 3 cytoplasmic domains . The human GJC2 gene encodes connexin-47 (Cx47), which is also referred to as connexin-46.6 (Cx46.6) or gap junction alpha-12 (GJA12) . While rat Gjc2 shares substantial homology with human GJC2, species-specific variations exist in amino acid sequence that may affect protein interaction profiles and channel properties. Both proteins play crucial roles in central myelination, with the human variant known to be involved in peripheral myelination as well .

What is the domain organization of Gjc2?

Gjc2, like other connexin proteins, displays a characteristic domain organization essential for its function:

  • Four transmembrane domains that anchor the protein within the cell membrane

  • Two extracellular domains that facilitate docking between connexons of adjacent cells

  • Three cytoplasmic domains (amino terminus, cytoplasmic loop, and carboxy terminus) that regulate channel function and interact with cytoplasmic partners

What are the primary functions of Gjc2 in rat models?

In rat models, Gjc2 primarily functions to:

  • Form gap junction channels that allow for intercellular communication through the diffusion of small molecules (<1 kDa), ions (K+, Ca2+), nutrients, and second messengers (IP3, cAMP)

  • Enable communication between oligodendrocytes or between oligodendrocytes and astrocytes in the central nervous system

  • Support the formation and maintenance of myelin in the central nervous system

  • Potentially participate in calcium regulation pathways, as evidenced by its involvement in calcium regulation in cardiac cells

Research indicates that proper Gjc2 function is essential for normal myelination processes in the rat brain, making it a valuable model for studying human demyelinating disorders.

How does the subcellular localization of Gjc2 relate to its function?

Gjc2 is predominantly localized to the plasma membrane of oligodendrocytes in the brain and spinal cord, particularly at points of contact with other oligodendrocytes or astrocytes . This strategic positioning facilitates the formation of gap junctions, which are essential for:

  • Intercellular communication necessary for coordinated myelin formation and maintenance

  • Ionic homeostasis between connected glial cells

  • Spatial buffering of extracellular potassium during neuronal activity

  • Metabolic coupling between oligodendrocytes and astrocytes

Mutations that prevent the connexin-47 protein from reaching the cell membrane disrupt gap junction formation, leading to myelin abnormalities observed in conditions like Pelizaeus-Merzbacher-like disease .

What expression systems are optimal for producing recombinant rat Gjc2?

Several expression systems have been successfully employed for recombinant Gjc2 production, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid productionMay lack proper post-translational modifications, potential inclusion body formation requiring refolding
Mammalian cells (HEK293)Native-like post-translational modifications, proper membrane insertionLower yield, higher cost, longer production time
Insect cellsHigher yield than mammalian systems, some post-translational modificationsIntermediate cost and complexity

For functional studies requiring properly folded and post-translationally modified Gjc2, mammalian expression systems are generally preferred . HEK293 cells in particular have been successfully used to express functional connexin proteins, allowing researchers to study gap junction formation and channel activity in a more physiologically relevant context.

What purification strategies yield the highest purity of functional Gjc2?

Purification of membrane proteins like Gjc2 requires specialized approaches:

  • Solubilization optimization: Screen different detergents (e.g., DDM, CHAPS, digitonin) to effectively solubilize Gjc2 while maintaining its native conformation.

  • Affinity chromatography: Utilizing tags such as His-tag or Avi-tag for initial capture . A typical approach involves:

    • Metal affinity chromatography (IMAC) for His-tagged Gjc2

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • If needed, ion exchange chromatography for final polishing

  • Reconstitution into proteoliposomes: For functional studies, purified Gjc2 can be reconstituted into liposomes to restore the membrane environment required for proper folding and function.

The choice of purification tag should be considered carefully—Fc-tagged variants may enhance solubility but potentially interfere with channel assembly, while smaller tags like His might have minimal impact on function .

How can researchers validate the functional activity of recombinant Gjc2?

Functional validation of recombinant Gjc2 can be accomplished through several complementary approaches:

  • Dye transfer assays: Using gap junction-permeable fluorescent dyes (e.g., Lucifer Yellow, calcein-AM) to measure intercellular communication between cells expressing recombinant Gjc2.

  • Electrophysiological measurements: Dual whole-cell patch-clamp recordings to directly measure gap junction conductance between coupled cells expressing Gjc2.

  • ATP release assays: Measuring the transfer of ATP or other small metabolites between cells as an indicator of functional gap junction activity.

  • Calcium wave propagation: Assessing the spread of calcium signals between connected cells as a functional readout of gap junction communication.

  • Proteoliposome-based assays: For purified protein, reconstitution into liposomes followed by permeability assays for small molecules can demonstrate channel functionality.

Validation should include positive controls (known functional connexins) and negative controls (connexin-null cells or cells expressing non-functional Gjc2 mutants).

How can recombinant Gjc2 be used to model myelination disorders?

Recombinant Gjc2 provides valuable tools for investigating myelination disorders, particularly those resembling human Pelizaeus-Merzbacher-like disease type 1 :

  • Structure-function studies: By introducing specific mutations identified in human patients into recombinant rat Gjc2, researchers can analyze how these alterations affect protein localization, gap junction formation, and channel function.

  • Cell-based disease models: Co-cultures of neurons with oligodendrocytes expressing wild-type or mutant Gjc2 can reveal how specific mutations impact myelination processes.

  • High-throughput screening platforms: Cells expressing disease-associated Gjc2 mutants can be used to screen for compounds that restore proper protein trafficking or enhance residual channel function.

  • Protein-protein interaction studies: Recombinant Gjc2 can be used to identify interaction partners that may be dysregulated in disease states, potentially revealing new therapeutic targets.

When designing such studies, it's important to consider that some human GJC2 mutations affect the promoter region, reducing protein production, while others affect protein trafficking or channel function . These different mechanisms may require distinct experimental approaches.

What techniques are most effective for studying Gjc2 interactions with other proteins?

Investigating Gjc2 protein interactions requires techniques capable of detecting membrane protein associations:

  • Co-immunoprecipitation: Using antibodies against Gjc2 or potential interaction partners (e.g., Ybx3 ) to pull down protein complexes from cellular lysates.

  • Proximity labeling approaches: BioID or APEX2 fused to Gjc2 can identify proximal proteins in living cells through biotinylation, followed by streptavidin pull-down and mass spectrometry.

  • FRET/BRET analysis: Fusion of fluorescent or bioluminescent proteins to Gjc2 and candidate partners enables real-time detection of protein interactions in living cells.

  • Split-protein complementation assays: Techniques like split-GFP or split-luciferase can demonstrate direct protein interactions when fragments fused to Gjc2 and partner proteins reconstitute active reporter proteins.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry can identify interaction interfaces between Gjc2 and binding partners.

These approaches have revealed interactions between Gjc2 and cytoskeletal proteins, trafficking machinery, and other connexins, providing insights into how these interactions may be dysregulated in disease states.

How does Gjc2 function in the context of the oligodendrocyte-astrocyte network?

Gjc2 plays a specialized role in the complex cellular network of the central nervous system:

  • Heterotypic channel formation: Gjc2 in oligodendrocytes forms heterotypic channels with other connexins (particularly Cx43) in astrocytes, creating a glial syncytium critical for spatial buffering of ions and metabolites .

  • Myelin maintenance signaling: Gap junctions formed by Gjc2 allow for the exchange of signals necessary for proper myelin maintenance, including:

    • Metabolic support between astrocytes and oligodendrocytes

    • Coordination of myelin repair processes

    • Transmission of calcium waves that may regulate oligodendrocyte function

  • Developmental regulation: The expression and function of Gjc2 change during development, correlating with critical periods of myelination.

Research methodologies to study these interactions include:

  • Organotypic slice cultures maintaining the complex cellular architecture

  • In vivo two-photon imaging of calcium dynamics in transgenic animals

  • Cell-specific knockout approaches to dissect the contribution of Gjc2 in different cell types

How can researchers overcome solubility issues with recombinant Gjc2?

Membrane proteins like Gjc2 present significant challenges for recombinant expression and purification. Effective strategies include:

  • Fusion partners optimization: Adding solubility-enhancing tags such as MBP, SUMO, or Fc can improve expression and solubility .

  • Detergent screening: Systematic testing of different detergents and lipid additives to identify optimal solubilization conditions that maintain protein stability.

  • Expression condition refinement:

    • Lowering expression temperature (e.g., 18-25°C instead of 37°C)

    • Using specialized E. coli strains designed for membrane protein expression

    • Adding chemical chaperones to the culture medium

  • Amphipol or nanodisc reconstitution: Transferring solubilized Gjc2 from detergent micelles to more stable membrane mimetics can improve long-term stability for structural and functional studies.

  • Co-expression with interacting partners: Co-expressing Gjc2 with known binding partners can sometimes enhance proper folding and stability.

For each new Gjc2 construct, a small-scale expression and solubility screen should be performed before scaling up production.

What are the most common pitfalls in functional assays involving recombinant Gjc2?

Researchers should be aware of several potential pitfalls when designing and interpreting Gjc2 functional studies:

  • Background coupling: Many cell lines used for heterologous expression already express endogenous connexins, which can contribute to observed coupling. Always include:

    • Connexin-deficient cell lines when possible

    • Controls with gap junction blockers (e.g., carbenoxolone, 18β-glycyrrhetinic acid)

    • Negative controls expressing non-functional Gjc2 mutants

  • Trafficking versus function: Some Gjc2 mutations affect trafficking to the membrane rather than channel function . Distinguishing between these mechanisms requires:

    • Surface biotinylation assays

    • Immunofluorescence microscopy to confirm membrane localization

    • Electrophysiological measurements of properly trafficked channels

  • Heterotypic interactions: Gjc2 may form heterotypic channels with other connexins, complicating interpretation of results. Consider:

    • Co-expression studies with potential partner connexins

    • Using connexin-null backgrounds for clean interpretations

  • Post-translational modifications: Functional properties of Gjc2 can be altered by phosphorylation and other modifications. Evaluate:

    • Phosphorylation status in experimental conditions

    • Effects of kinase inhibitors/activators on channel function

What are the emerging roles of Gjc2 in neurological disorders beyond demyelinating diseases?

While Gjc2/GJC2 is well-established in demyelinating disorders like Pelizaeus-Merzbacher-like disease , recent research suggests broader implications:

  • Lymphatic system involvement: Heterozygous missense mutations in human GJC2 have been linked to pubertal onset hereditary lymphedema , suggesting previously unrecognized roles in lymphatic vessel development or function.

  • Spastic paraplegia: GJC2 has been implicated in Spastic Paraplegia 44 , indicating potential roles in motor neuron function beyond myelination.

  • Calcium signaling pathways: Gjc2's involvement in calcium regulation pathways suggests potential roles in disorders involving disrupted calcium homeostasis in the nervous system.

Future research directions should explore:

  • Conditional knockout models targeting specific cell populations

  • Temporal regulation of Gjc2 function during development and in adult plasticity

  • Potential roles in non-CNS tissues where Gjc2 expression has been detected

How do expression systems impact the translational relevance of recombinant Gjc2 studies?

The choice of expression system for recombinant Gjc2 significantly influences the translational value of research findings:

Expression SystemAdvantages for Translational ResearchLimitations
Rat primary cellsMost physiologically relevant for rat Gjc2 studiesLimited protein yield, challenging to manipulate
HEK293 cellsGood membrane trafficking, mammalian post-translational modificationsMay lack oligodendrocyte-specific interaction partners
E. coliHigh yield for structural studiesLacks post-translational modifications critical for function

For translational studies aiming to develop therapeutics targeting Gjc2:

  • Consider the disease mechanism being addressed (e.g., trafficking defects vs. channel dysfunction)

  • Validate findings across multiple expression systems

  • Confirm key discoveries in primary cells or tissues when possible

  • Use animal models that accurately reflect the human condition

The most robust translational findings typically emerge from complementary approaches using both recombinant systems and endogenous protein studies.

What novel methodologies show promise for advancing Gjc2 research?

Emerging technologies with significant potential for Gjc2 research include:

  • Cryo-electron microscopy: Recent advances have enabled structural determination of membrane proteins at near-atomic resolution, potentially allowing visualization of Gjc2 channel structure and conformational changes.

  • Genome editing in primary cells: CRISPR-Cas9 editing of Gjc2 in primary oligodendrocytes allows for precise manipulation of the endogenous protein in its native context.

  • Organoid models: Brain organoids containing oligodendrocytes can provide more physiologically relevant environments for studying Gjc2 function in a three-dimensional context with appropriate cellular interactions.

  • In vivo optical physiology: Genetically encoded voltage or calcium indicators coupled with two-photon microscopy allow real-time monitoring of gap junction communication in living tissue.

  • Single-molecule imaging techniques: Super-resolution microscopy and single-particle tracking approaches can reveal the dynamics of Gjc2 assembly into gap junction plaques and their turnover.

These methodologies, when combined with traditional biochemical and electrophysiological approaches, promise to provide unprecedented insights into Gjc2 biology and pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.