Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gipr; Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-455
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTAR VSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQVVY TVGYSLSLATLLLALLILSLFRRLHCTRNYIHMNLFTSFMLRAGAILTRDQLLPPLGPYT GNQTPTLWNQALAACRTAQILTQYCVGANYTWLLVEGVYLHHLLVVVRRSEKGHFRCYLL LGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILITILINFLIFIRILGIL VSKLRTRQMRCPDYRLRLARSTLTLMPLLGVHEVVFAPVTEEQAEGSLRFAKLAFEIFLS SFQGFLVSVLYCFINKEVQSEIRRLRLSLQEQCPRPHLGQAPRAVPLSSAPQEAAIRNAL PSGMLHVPGDEVLESYC
Uniprot No.

Target Background

Function

This is a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins that activate adenylyl cyclase.

Gene References Into Functions

Relevant Research:

  1. Glucose-dependent insulinotropic polypeptide and its receptor expression in rat salivary glands, and variations during growth. PMID: 24360021
  2. Signaling pathway disruption may contribute to reduced beta-cell GIP receptor expression and GIP resistance in type 2 diabetes. PMID: 20332343
  3. A novel pathway for GIP receptor downregulation in pancreatic beta cells. PMID: 12475913
  4. GIP receptor expression in cultured adult hippocampal progenitors and the dentate gyrus granule cell layer, indicating GIP responsiveness in these cells. PMID: 15716418
  5. High glucose-induced GLP-1 receptor expression reduction is prevented by dominant-negative protein kinase C (PKC)alpha. PMID: 17360984
  6. GIP receptor ubiquitination leads to downregulation of GIP activity. PMID: 17505054
  7. Rodent type 2 diabetes GIP receptor downregulation appears secondary to chronic hyperglycemia, with glycemic normalization restoring GIP sensitivity. PMID: 17803965
Database Links

KEGG: rno:25024

STRING: 10116.ENSRNOP00000021456

UniGene: Rn.9676

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Present in the pancreas as well as the gut, adipose tissue, heart, pituitary, and inner layers of the adrenal cortex, whereas it is not found in kidney, spleen, or liver. It is also expressed in several brain regions, including the cerebral cortex, hippoc

Q&A

What is the structure of recombinant rat Gipr used in research?

Recombinant rat Gipr protein typically consists of a specific amino acid sequence corresponding to the extracellular domain of the native receptor. Based on current production methods, the recombinant protein often represents amino acids 19 to 135 of the rat Gipr protein sequence, which encompasses the critical ligand-binding region. This protein fragment is commonly fused with a 10xHis-tag at the C-terminus to facilitate purification and detection in experimental settings. This design ensures that the protein maintains its functional binding capacity while allowing researchers to easily isolate it from expression systems. The resulting protein typically exhibits high purity (>95% as determined by SDS-PAGE) with low endotoxin levels (<1.0 EU/μg), making it suitable for a variety of in vitro and ex vivo research applications .

How does rat Gipr compare to human Gipr?

Mouse Gipr (which shares high homology with rat Gipr) exhibits approximately 83% sequence homology with human Gipr, indicating substantial structural and functional conservation across these species. This significant homology serves as the scientific basis for using rat models in translational research related to human metabolic disorders. The conserved structural elements primarily include the ligand-binding domains and key signaling motifs that are essential for receptor function. Despite this high degree of conservation, species-specific differences in receptor regulation, post-translational modifications, and downstream signaling pathways necessitate careful interpretation when extrapolating findings from rat models to human applications. The similarity in structure and function makes rat Gipr a valuable research tool for developing cross-species therapeutic agents targeting obesity and metabolic disorders .

What expression systems are optimal for producing functional recombinant rat Gipr?

The mammalian cell expression system represents the gold standard for producing functional recombinant rat Gipr. This methodology involves several critical steps: (1) gene sequence isolation corresponding to amino acids 19-135 of rat Gipr, (2) fusion with a 10xHis-tag at the C-terminus, (3) integration into an appropriate plasmid vector, (4) transfection into mammalian cells, (5) cultivation of transfected cells for protein expression, and (6) protein harvesting from cell lysates. This approach offers significant advantages over bacterial or insect cell systems, particularly for maintaining proper protein folding and post-translational modifications essential for receptor functionality. The mammalian expression system ensures that the recombinant protein maintains physiologically relevant binding properties and signal transduction capabilities. Quality control typically includes SDS-PAGE for purity assessment (>95%) and LAL testing for endotoxin levels (<1.0 EU/μg) .

How can researchers validate the functional activity of recombinant rat Gipr?

Functional validation of recombinant rat Gipr requires multiple complementary approaches to confirm both binding capacity and downstream signaling capabilities. A standard approach involves functional ELISA assays, where the recombinant Gipr is immobilized (typically at 2 μg/mL) and tested for binding with specific antibodies. Binding curves generate EC50 values (ranging from 6.946 to 8.740 ng/ml in validated protocols) that provide quantitative measures of binding affinity. Beyond binding assays, functional validation should include assessment of cAMP production in responsive cell lines, as Gipr activation triggers adenylyl cyclase and subsequent cAMP elevation. Additionally, calcium mobilization assays and receptor internalization studies offer complementary measures of receptor functionality. These multi-dimensional approaches ensure that the recombinant protein retains physiologically relevant properties suitable for downstream research applications .

What animal models are appropriate for studying Gipr function in diabetes research?

The Vancouver Zucker Diabetic Fatty (VDF) rat represents a well-characterized model for studying Gipr dysfunction in type 2 diabetes. These rats are homozygous recessive for a mutation in the leptin receptor gene (fa, Gln 269Pro), leading to obesity, insulin resistance, glucose intolerance, and hyperinsulinemia—phenotypes that closely mirror human type 2 diabetes. When designing studies with this model, researchers should consider the following parameters: (1) optimal age range (14-16 weeks when diabetic phenotypes are fully established), (2) sex differences (males typically show more pronounced phenotypes), (3) appropriate lean littermate controls (heterozygous for the fa mutation), and (4) comprehensive metabolic characterization (glucose tolerance tests, insulin measurements, and pancreatic perfusion studies). This model offers unique advantages for investigating GIP resistance, as VDF rats exhibit decreased Gipr expression and significant impairment in GIP-stimulated insulin secretion while maintaining GLP-1 responsiveness .

How can intraperitoneal glucose tolerance tests be optimized to evaluate Gipr function?

The intraperitoneal glucose tolerance test (IPGTT) protocol for evaluating Gipr function requires careful methodological considerations to ensure robust and reproducible results. The optimal procedure includes:

  • Animal preparation: Anesthetize rats with sodium pentobarbital (65 mg/kg) via intraperitoneal injection

  • Cannulation: Expose and cannulate the right jugular vein with heparinized polyethylene tubing (PE50)

  • GIP infusion: Administer GIP at 4 pmol·min⁻¹·kg⁻¹ (30 μl/min) via cannula for 5 minutes before glucose challenge

  • Glucose challenge: Inject 40% glucose solution (1 g/kg) intraperitoneally

  • Blood sampling: Collect 0.5 ml blood samples from the tail vein at -5 (basal), 10, 20, 30, and 60 minutes post-glucose

  • Glucose measurements: Monitor blood glucose levels at baseline and every 10 minutes after glucose administration

  • Plasma separation: Centrifuge blood samples at 10,000 g for 20 minutes at 4°C

  • Analysis: Perform radioimmunoassays for GIP and insulin on collected plasma

This protocol allows for quantitative assessment of GIP's effect on glucose tolerance and insulin secretion, with the integrated glucose and insulin responses calculated as areas under the curve (AUC) .

What techniques are used to measure Gipr expression in pancreatic islets?

Quantifying Gipr expression in pancreatic islets requires a multi-faceted approach combining molecular and protein-level analyses:

RNA Expression Analysis:

  • Islet isolation using collagenase digestion

  • Total RNA extraction with high-quality isolation (RNA purity indicated by A260/A280 ratios ≥1.80)

  • Reverse transcription using gene-specific primers targeting the COOH-terminus of rat Gipr

  • Real-time PCR quantification with specific primers:

    • Forward primer: 5'-CCG CGC TTT TCG TCA TCC-3'

    • Reverse primer: 5'-CCA CCA AAT GGC TTT GAC TT-3'

    • Fluorescent probe: 5'-CCC AGC ACT GCG TGT TCT CGT ACA GG-3'

Protein Expression Analysis:

  • Islet protein extraction using RIPA buffer

  • Protein quantification via Bradford or BCA assay

  • Western blot analysis with Gipr-specific antibodies

  • Immunohistochemistry to evaluate cellular distribution

Normalizing Gipr expression to housekeeping genes such as GAPDH ensures accurate quantification across experimental groups. This comprehensive approach enables reliable detection of changes in Gipr expression under various experimental conditions, such as the decreased expression observed in VDF rats .

How can pancreatic perfusion studies be designed to assess Gipr-mediated insulin secretion?

Pancreatic perfusion represents a gold-standard technique for evaluating Gipr-mediated insulin secretion in isolated intact pancreas. A methodologically robust protocol includes:

  • Surgical preparation:

    • Anesthetize rats with sodium pentobarbital (65 mg/kg)

    • Cannulate the aorta and portal vein

    • Isolate the pancreas with minimal manipulation

  • Perfusion parameters:

    • Use HEPES-buffered Krebs-Ringer bicarbonate buffer (KRBH)

    • Maintain temperature at 37°C

    • Set flow rate at 3 ml/min

    • Oxygenate buffer with 95% O₂/5% CO₂

  • Experimental design:

    • Establish baseline with buffer containing 2.8 mmol/l glucose (20 min)

    • Transition to 8.8 mmol/l glucose to stimulate first-phase insulin secretion

    • Add test substances (GIP at 10 pmol/l or GLP-1 at 50 pmol/l) during glucose stimulation

    • Collect perfusate at 1-minute intervals

  • Analysis:

    • Measure insulin concentration by radioimmunoassay

    • Calculate first and second-phase responses

    • Compare responses between experimental groups

This approach allows direct assessment of pancreatic β-cell responsiveness to GIP under controlled conditions, revealing important physiological differences between normal and diabetic models. For example, in VDF rats, 10 pmol/l GIP fails to stimulate the characteristic biphasic insulin response seen in lean controls .

What mechanisms contribute to decreased Gipr expression and function in diabetic models?

Multiple molecular mechanisms contribute to the downregulation of Gipr expression and function in diabetic models, particularly in VDF rats. Research indicates a complex interplay of factors:

  • Transcriptional regulation: Decreased Gipr mRNA levels in VDF rat islets suggest transcriptional downregulation, potentially involving altered binding of transcription factors to the Gipr promoter under diabetic conditions.

  • Post-transcriptional mechanisms: Changes in mRNA stability and processing may contribute to reduced Gipr expression.

  • Translational and post-translational modifications: Impaired protein synthesis or enhanced degradation can reduce functional receptor levels on the cell surface.

  • Receptor desensitization: Chronic exposure to elevated GIP levels may lead to receptor internalization and degradation, contributing to decreased surface expression.

  • Metabolic alterations: Chronic hyperglycemia and hyperlipidemia can impair Gipr signaling through various cellular mechanisms, including oxidative stress and inflammation.

  • Altered G-protein coupling: Research suggests potential defects in the coupling between Gipr and adenylyl cyclase, as evidenced by reduced cAMP production in response to GIP stimulation in diabetic models.

These mechanisms likely work in concert, resulting in the observed phenotype of GIP resistance despite preserved GLP-1 responsiveness in diabetic models. This selective impairment in the incretin effect has important implications for understanding the pathophysiology of type 2 diabetes .

How can researchers differentiate between GIP and GLP-1 effects in pancreatic studies?

Differentiating between GIP and GLP-1 effects requires systematic experimental approaches that leverage the distinct properties of these incretin hormones:

  • Comparative dose-response studies:

    • Conduct parallel experiments with equimolar concentrations of GIP and GLP-1

    • Measure insulin secretion across a range of peptide concentrations (typically 1-100 pmol/l)

    • Compare EC50 values and maximal responses

  • Receptor-specific antagonists:

    • Use GIP(3-42) as a specific GIP receptor antagonist

    • Apply exendin(9-39) as a GLP-1 receptor antagonist

    • Evaluate the degree of inhibition with each antagonist

  • Receptor knockout or knockdown models:

    • Utilize siRNA or CRISPR-Cas9 technology to selectively reduce expression of either receptor

    • Compare effects of both incretins in receptor-deficient models

  • Downstream signaling pathway analysis:

    • Measure cAMP production as the primary second messenger

    • Assess calcium mobilization patterns

    • Evaluate PKA and EPAC activation

    • Compare patterns of gene expression changes

  • Sequential stimulation protocol:

    • Apply one hormone followed by the other

    • Analyze additive or synergistic effects

    • Assess potential receptor desensitization

In diabetic models like the VDF rat, these approaches reveal striking differences: while 10 pmol/l GIP and 50 pmol/l GLP-1 have similar insulinotropic effects in lean animals, only GLP-1 retains the ability to potentiate glucose-induced insulin secretion in diabetic pancreas .

What statistical approaches are recommended for analyzing Gipr-related metabolic pathway data?

Analyzing Gipr-related metabolic pathway data requires sophisticated statistical methodologies to handle the complexity and high dimensionality of the data. Recommended approaches include:

  • Multivariate imputation for missing data:

    • Implement multivariate imputation by chained equations (MICE)

    • Consider only metabolites with <50% missingness

    • Generate multiple imputation sets (typically 20) for robust analysis

    • Standardize measures (mean = 0, SD = 1) after imputation

  • Correlation network analysis:

    • Calculate partial correlations between metabolite pairs

    • Apply Fisher Z transformation to normalize correlation distributions

    • Pool estimates across multiple imputations using Rubin's rules

    • Meta-analyze results using fixed-effects, inverse variance-weighted methods

    • Consider partial correlations significant at Bonferroni-corrected thresholds (e.g., P ≤ 1.28 × 10⁻⁷)

    • Construct Gaussian graphical models for visual representation of metabolite relationships

  • Genetic colocalization analyses:

    • Implement multitrait colocalization (HyPrColoc) at the GIPR locus

    • Identify cardiometabolic traits sharing common causal variants

    • Partition clusters of traits driven by distinct causal variants

    • Apply appropriate priors (e.g., 1 × 10⁻⁴ and 0.02)

    • Use regional and alignment thresholds of 0.5

    • Assess sensitivity using increasingly stringent configurations

  • Pathway enrichment analysis:

    • Identify significantly enriched biological pathways

    • Control for multiple testing using false discovery rate or Bonferroni correction

    • Visualize results using enrichment maps or pathway diagrams

These statistical approaches enable comprehensive analysis of complex metabolic data related to Gipr function, facilitating the identification of novel biological insights and potential therapeutic targets .

How does Gipr research inform therapeutic approaches for diabetes and obesity?

Gipr research has revealed critical insights that directly inform therapeutic approaches for metabolic disorders:

  • Dual incretin receptor targeting: Understanding the differential preservation of GLP-1 versus GIP sensitivity in diabetic states has led to the development of dual GIP/GLP-1 receptor agonists. This approach capitalizes on the complementary mechanisms of these incretins, potentially offering superior glycemic control and weight reduction compared to single-receptor targeting.

  • GIP receptor antagonism: Paradoxically, some research suggests that GIP receptor antagonism may be beneficial in obesity, based on observations that Gipr signaling promotes fat storage. This has stimulated interest in developing Gipr antagonists as potential anti-obesity agents.

  • Pancreatic β-cell preservation: Gipr activation promotes β-cell proliferation and survival, suggesting potential applications in preserving functional β-cell mass in diabetes. Research in rat models demonstrates that GIP-Gipr signaling not only stimulates insulin secretion but also supports β-cell function through anti-apoptotic mechanisms.

  • Personalized medicine approaches: The discovery of Gipr downregulation in diabetic states suggests potential therapeutic strategies to restore receptor expression or function. Additionally, genetic variations in the Gipr gene may predict individual responses to incretin-based therapies, informing personalized treatment approaches.

  • Metabolic pathway interactions: Gipr research has illuminated important cross-talk between multiple metabolic pathways, including adipose tissue function, bone metabolism, and neural signaling. These insights suggest novel therapeutic targets beyond traditional glucose regulation.

The understanding that diabetes involves selective resistance to GIP while preserving GLP-1 sensitivity has directly influenced the development of next-generation incretin-based therapies, representing a clear translation from basic receptor research to clinical applications .

What are the key considerations when using recombinant rat Gipr for in vitro binding studies?

When designing in vitro binding studies with recombinant rat Gipr, researchers should consider several critical factors to ensure reliable and physiologically relevant results:

  • Protein quality parameters:

    • Purity (>95% by SDS-PAGE)

    • Endotoxin levels (<1.0 EU/μg by LAL method)

    • Batch-to-batch consistency in binding affinity

    • Storage conditions (-80°C with minimal freeze-thaw cycles)

  • Experimental design considerations:

    • Immobilization method (optimal concentration ~2 μg/mL)

    • Buffer composition (pH, ionic strength, presence of stabilizers)

    • Incubation time and temperature

    • Detection system sensitivity and linear range

    • Appropriate positive and negative controls

  • Binding kinetics assessment:

    • Determination of association and dissociation rate constants

    • Calculation of equilibrium dissociation constant (KD)

    • Evaluation of EC50 values (typically 6.946-8.740 ng/ml for validated antibodies)

    • Analysis of cooperativity and potential allosteric effects

  • Comparative analysis:

    • Parallel testing with native receptor-expressing cells

    • Comparison with human Gipr to assess species differences

    • Evaluation of cross-reactivity with related receptors

  • Functional correlation:

    • Correlation between binding affinity and downstream signaling activation

    • Assessment of partial versus full agonism

    • Identification of biased signaling properties

Rigorous attention to these methodological details ensures that binding studies yield physiologically meaningful data that can inform both basic research and drug development efforts targeting the Gipr system .

What are the current limitations in Gipr research models and how might they be addressed?

Current Gipr research faces several methodological challenges that limit full understanding of receptor function and therapeutic potential:

  • Species-specific differences: Despite 83% homology between rat and human Gipr, significant species-specific differences in regulation and signaling exist. Future research should incorporate humanized mouse models or human islet studies to better translate findings to clinical applications.

  • Tissue-specific Gipr function: Gipr is expressed in multiple tissues (pancreas, adipose tissue, bone, brain), but most research focuses on pancreatic effects. Development of tissue-specific conditional knockout models would enable comprehensive investigation of Gipr's pleiotropic effects.

  • Dynamic regulation assessment: Current methods typically measure static Gipr levels rather than dynamic regulation. Implementation of real-time imaging techniques and biosensors to monitor receptor trafficking and signaling in living cells would advance understanding of Gipr dynamics.

  • Compensatory mechanisms: Long-term Gipr manipulation often triggers compensatory changes in related signaling pathways. Systems biology approaches combining transcriptomics, proteomics, and metabolomics could better characterize these adaptive responses.

  • Translational barriers: Discrepancies between preclinical models and clinical outcomes highlight translational challenges. Developing patient-derived organoids or using genome editing in primary human cells may provide more clinically relevant models.

  • Technical limitations in structural biology: Limited structural information about membrane-bound Gipr impedes rational drug design. Advances in cryo-electron microscopy and computational modeling could facilitate structure-based drug discovery targeting Gipr.

Addressing these limitations requires multidisciplinary approaches combining molecular biology, physiology, pharmacology, and computational modeling to develop more predictive and translatable research paradigms .

How might multitrait colocalization analysis advance understanding of Gipr's role in cardiometabolic diseases?

Multitrait colocalization analysis represents a powerful genetic epidemiology approach to unravel the complex relationships between Gipr function and cardiometabolic diseases:

  • Identification of shared causal variants: This methodology can identify common genetic variants at the GIPR locus that simultaneously influence multiple cardiometabolic traits, suggesting mechanistic links between Gipr function and disease pathways.

  • Trait clustering based on genetic architecture: By applying tools such as HyPrColoc with appropriate prior configurations (e.g., 1 × 10⁻⁴ and 0.02) and thresholds (0.5), researchers can partition cardiometabolic traits into clusters driven by distinct causal variants, revealing the pleiotropic effects of different Gipr-related genetic mechanisms.

  • Causal inference across metabolic traits: This approach facilitates distinction between correlation and causation by identifying shared genetic determinants across traits such as:

    • Glycemic measures (fasting glucose, HbA1c, 2-hour glucose)

    • Insulin sensitivity parameters

    • Lipid profiles (LDL, HDL, triglycerides)

    • Cardiovascular risk factors

  • Integration with metabolomic data: Combining genetic colocalization with metabolomic analyses creates a powerful framework for identifying Gipr-influenced metabolic pathways that contribute to cardiometabolic risk.

  • Therapeutic target validation: By establishing genetic links between Gipr variation and disease outcomes, this approach can validate or challenge the rationale for therapeutic targeting of Gipr in specific cardiometabolic conditions.

  • Precision medicine applications: Identification of specific genetic variants that influence both Gipr function and disease risk could enable stratification of patients for targeted therapies.

Through systematic application of these approaches with increasingly stringent statistical thresholds, researchers can develop a more nuanced understanding of how Gipr biology influences the complex landscape of cardiometabolic diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.