Recombinant Rat Ghrelin O-acyltransferase (Mboat4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
Mboat4; Goat; Ghrelin O-acyltransferase; Membrane-bound O-acyltransferase domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mboat4
Target Protein Sequence
MDWLQFFFLHPVSLYQGAAFPFALLFNYLCITESFPTRARYLFLLAGGGVLALAAMGPYA LLIFIPALCAVAMISSLSPQEVHGLTFFFQMGWQTLCHLGLHYKEYYLCEPPPVRFYITL SSLMLLTQRVTSLSLDISEGKVEAAWRGTRSRSSLCEHLWDALPYISYLLFFPALLGGSL CSFQRFQACVQRPRSLYPSISFWALTWRGLQILGLECLKVALRRVVSAGAGLDDCQRLEC IYIMWSTAGLFKLTYYSHWILDDSLLHAAGFGSEAGQRPGEERYVPDVDIWTLETTHRIS LFARQWNRSTAQWLKRLVFQRSRRWPVLQTFAFSAWWHGLHPGQVFGFLCWSVMVKADYL IHTFANGCIRSWPLRLLYRSLTWAHTQIIIAYVMLAVEGRSFSSLCRLCCSYNSIFPVTY CLLLFLLARRKHKCN
Uniprot No.

Target Background

Function
This enzyme mediates the octanoylation of ghrelin at 'Ser-3'. It can utilize a variety of fatty acids as substrates, including octanoic acid, decanoic acid, and tetradecanoic acid.
Gene References Into Functions
  1. GOAT immunoreactivity is concentrated at the base of the dentate granule cell layer in the rat. This immunoreactivity remains unaffected by pharmacological inhibition of GHSR1a or fluctuations in systemic ghrelin levels caused by metabolic state changes. PMID: 29063591
  2. Expression of hypothalamic ghrelin O-acyltransferase influences the body mass of rats fed a high-fat diet. PMID: 26028164
  3. Ghrelin O-acyltransferase is present in murine pancreatic islet cells, and insulin inhibits its expression through mTOR signaling. PMID: 21063108
  4. Ghrelin-O-acyltransferase (GOAT) mRNA in the stomach of adult rats is up-regulated 21-fold compared to young rats and 14-fold compared to adult rats on a dietary restriction. PMID: 20149910
  5. These findings suggest species differences between rats and mice in gastric GOAT expression, potentially leading to a distinct role of the MBOAT4 enzyme in the rat stomach. PMID: 20059966
  6. The results suggest that increased GOAT mRNA levels may play a role in mediating physiological responses to chronic undernutrition and could represent an adaptive mechanism to prevent long-lasting alterations in energy balance and body weight homeostasis. PMID: 18835978

Show More

Hide All

Database Links
Protein Families
Membrane-bound acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ghrelin O-acyltransferase in physiological systems?

Ghrelin O-acyltransferase (GOAT) plays a central role in the maturation and activation of the peptide hormone ghrelin, which performs a wide range of endocrinological signaling functions. GOAT is responsible for attaching an octanoyl group to the serine-3 residue of ghrelin, which is essential for ghrelin to bind to its receptor (GHS-R1a) and exert its biological effects. This post-translational modification is unique within the human proteome, making GOAT the only known enzyme that catalyzes this specific acylation reaction . The acylation of ghrelin is required for its effects on appetite stimulation, energy homeostasis, and various metabolic functions, positioning GOAT as a critical regulatory point in these physiological processes.

What are the optimal expression systems for producing functional recombinant rat GOAT?

Insect cell expression systems have proven to be particularly effective for the production of functional recombinant GOAT. Researchers have successfully used baculovirus-infected insect cells to express mouse GOAT, which shares high homology with rat GOAT. The membrane fractions from these cells retain enzymatic activity and can effectively transfer octanoyl groups from octanoyl-CoA to recombinant proghrelin in vitro .

When establishing an expression system for recombinant rat GOAT, several factors should be considered:

  • The need for proper membrane integration, as GOAT is a multi-pass membrane protein

  • Post-translational modifications that may be required for activity

  • The lipid environment needed for optimal enzyme function

  • Potential toxicity when overexpressed

Mammalian cell lines such as HEK293 cells may also be used, particularly when studying GOAT in a context closer to its native environment, though yields are typically lower than in insect cell systems .

How can I confirm the enzymatic activity of recombinant rat GOAT preparations?

The enzymatic activity of recombinant rat GOAT can be verified through several complementary approaches:

In vitro acylation assay: Membrane fractions containing GOAT can be incubated with recombinant proghrelin and [³H]octanoyl-CoA. The transfer of the [³H]octanoyl group to proghrelin can be measured by separation of the products using SDS-PAGE followed by fluorography or scintillation counting . A successful reaction will show incorporation of radioactivity into the proghrelin protein band.

Mass spectrometry verification: LC-MS/MS analysis can detect the addition of the octanoyl group to the serine-3 residue of ghrelin, providing direct evidence of GOAT activity. This approach allows precise identification of the modification site and quantification of acylation efficiency .

Cell-based acylation assay: Co-expression of GOAT and preproghrelin in cell lines like INS-1 cells, followed by analysis of acylated ghrelin production. Octanoyl-ghrelin can be separated from desacyl-ghrelin by elution from a reverse-phase column with 40% acetonitrile . This approach verifies GOAT functionality in a cellular context.

What is the most reliable biochemical assay for measuring rat GOAT activity in vitro?

The most reliable biochemical assay for measuring rat GOAT activity involves using membrane fractions containing the enzyme with appropriate substrates. Based on established protocols, the following methodology offers consistent and quantifiable results:

Assay components:

  • Membrane fractions from insect cells expressing rat GOAT

  • Purified recombinant proghrelin as the acyl acceptor

  • [³H]octanoyl-CoA as the acyl donor

  • Buffer system: 50 mM HEPES (pH 7.0), containing protease inhibitors

Reaction conditions:

  • Temperature: 37°C

  • Incubation time: 5-30 minutes (linearity should be confirmed)

  • Substrate concentrations: 1-5 μM proghrelin, 1-10 μM [³H]octanoyl-CoA

Detection methods:

  • SDS-PAGE separation followed by fluorography

  • Scintillation counting of precipitated proghrelin

  • Immunoprecipitation of ghrelin followed by scintillation counting

This assay system can detect GOAT activity with high sensitivity and specificity. The activity levels can be quantified by measuring the incorporation of radioactive octanoyl groups into the proghrelin substrate over time . Control reactions should include samples with heat-inactivated GOAT or with mutant proghrelin (S3A) that cannot be octanoylated.

How can I design effective inhibitors for rat GOAT based on structure-activity relationships?

Designing effective inhibitors for rat GOAT requires understanding the structural determinants of substrate recognition and catalysis. Based on published research, the following approach is recommended:

Key structural elements to target:

  • N-terminal recognition elements: GOAT recognizes glycine-1, serine-3, and phenylalanine-4 of ghrelin, which are essential for binding . Inhibitors should incorporate these recognition elements.

  • Acylation site modifications: Replacing serine-3 with diaminopropionic acid (Dap) allows attachment of the octanoyl group through an amide linkage rather than an ester, significantly enhancing inhibitory potency (35 to 45-fold improvement) .

  • Acyl chain optimization: The octanoyl (8-carbon) chain is optimal for GOAT recognition. Longer chains like myristoyl (14-carbon) or palmitoyl (16-carbon) eliminate inhibitory activity .

Design strategy table:

Structural ElementOptimization StrategyEffect on Potency
N-terminal sequenceMaintain GSSFL motifEssential for recognition
C-terminusAmidationEnhances binding affinity
Acylation siteSer → Dap substitution35-45 fold potency increase
Acyl chainOctanoyl (8C)Optimal; longer chains reduce activity
Peptide lengthPentapeptide sufficientMinimal effective inhibitor size

A pentapeptide containing only the N-terminal five amino acids of proghrelin (GSSFL-NH₂) with an octanoylated Dap at position 3 represents one of the most potent inhibitor designs, achieving 50% inhibition at approximately 1 μM concentration .

What are the optimal conditions for expressing and purifying rat GOAT for structural studies?

Structural studies of rat GOAT present significant challenges due to its nature as a multi-pass membrane protein. Based on current research approaches, the following optimized conditions are recommended:

Expression system selection:

  • Insect cell expression (preferred): Sf9 or High Five cells using baculovirus vectors provide higher yields and proper folding of membrane proteins

  • Yeast expression: Pichia pastoris can be considered as an alternative system offering proper eukaryotic processing

  • Mammalian expression: HEK293 GnTI- cells may provide native-like glycosylation patterns when required

Optimization parameters:

  • Temperature: Lowering expression temperature to 27°C for insect cells improves proper folding

  • Induction time: Extended expression periods (48-72 hours) at lower temperatures

  • Addition of lipids: Supplementing with cholesterol or specific phospholipids can enhance stability

Purification strategy:

  • Membrane extraction using mild detergents (DDM, LMNG, or GDN)

  • Affinity chromatography using tandem tags (e.g., His8-MBP or His10-FLAG)

  • Size exclusion chromatography in detergent or lipid nanodiscs

  • Quality assessment by enzyme activity assays to confirm functional state

Stabilization for structural studies:

  • Incorporation into nanodiscs or amphipols

  • Addition of high-affinity ligands, such as the octanoylated [Dap³]-ghrelin peptide

  • Use of thermostabilizing mutations identified through alanine scanning

While no high-resolution structure of GOAT has been reported to date, these approaches maximize the likelihood of obtaining stable, active preparations suitable for structural techniques such as cryo-EM, X-ray crystallography, or NMR studies .

How does the cellular localization of GOAT affect its interaction with ghrelin?

Recent research has significantly revised our understanding of GOAT's cellular localization and its implications for ghrelin processing. While traditionally viewed as an endoplasmic reticulum (ER) resident enzyme, new evidence indicates that GOAT is also distributed to the plasma membrane . This dual localization creates multiple interaction points with ghrelin:

Intracellular interactions: Within the ER, GOAT encounters newly synthesized proghrelin and catalyzes the octanoylation of serine-3, as part of the canonical secretory pathway. This represents the well-established pathway for producing acylated ghrelin that will be secreted.

Extracellular interactions: The presence of GOAT on the plasma membrane enables interactions with extracellular ghrelin. Fluorescently labeled ghrelin-derived peptides with high GOAT selectivity have demonstrated that GOAT can facilitate ligand cell internalization in both transfected cells and prostate cancer cells endogenously expressing GOAT . This suggests that GOAT might function as a cell-surface receptor or transporter for ghrelin in addition to its acyltransferase activity.

These findings introduce a new paradigm where GOAT's function extends beyond simple intracellular acylation to potentially include:

  • Recognition of circulating ghrelin

  • Facilitation of ghrelin uptake into cells

  • Potential signaling functions independent of GHS-R1a

  • Possible re-acylation of deacylated ghrelin after cellular uptake

This dual localization may explain why GOAT is expressed in tissues that do not produce ghrelin, suggesting broader physiological roles for this enzyme than previously recognized .

What structural features of the GOAT active site are critical for catalysis?

Understanding the structural features of GOAT's active site is challenging due to the absence of a high-resolution structure, but biochemical and mutagenesis studies have provided significant insights into the catalytic machinery of this enzyme:

Key catalytic residues:

  • Histidine general base: Mutagenesis studies coupled with ligand uptake experiments provide direct evidence supporting the interaction of a catalytic histidine residue within GOAT with the ghrelin peptide acylation site . This histidine likely deprotonates the serine-3 hydroxyl group of ghrelin to facilitate nucleophilic attack on the octanoyl-CoA thioester.

  • Conserved MBOAT domain residues: As a member of the membrane-bound O-acyltransferase (MBOAT) family, GOAT contains conserved asparagine and histidine residues that are essential for catalytic activity across this enzyme family.

Substrate binding pocket characteristics:

  • Specific N-terminal recognition region: The active site accommodates the N-terminal GSSFL sequence of ghrelin, with strict requirements for glycine-1, serine-3, and phenylalanine-4 .

  • Octanoyl-CoA binding region: The enzyme shows specificity for medium-chain fatty acids, particularly octanoate, suggesting a defined hydrophobic pocket that accommodates the acyl chain.

  • Catalytic geometry: The spatial arrangement places the serine-3 hydroxyl of ghrelin in close proximity to both the catalytic histidine and the thioester carbonyl of octanoyl-CoA.

These structural features create a highly specific catalytic environment that explains GOAT's remarkable selectivity for ghrelin as its only known physiological substrate within the human proteome .

How does the inhibitory potency of modified ghrelin peptides correlate with their chemical stability?

The relationship between inhibitory potency and chemical stability of modified ghrelin peptides reveals important insights into both GOAT's mechanism and potential therapeutic strategies:

Ester versus amide linkages:
Modified ghrelin peptides containing an octanoyl group attached through an amide linkage (using diaminopropionic acid, Dap) demonstrate 35-45 fold higher inhibitory potency compared to their ester-linked counterparts . This dramatic potency increase correlates with the greater chemical stability of amide bonds compared to esters, which are susceptible to hydrolysis.

Comparative stability and potency data:

Peptide ModificationIC₅₀ ValueRelative PotencyChemical Stability
Oct-Ser³-ghrelin(1-28)7 μMLower (ester linkage)
Oct-[Dap³]-ghrelin(1-28)0.2 μM35×Higher (amide linkage)
Oct-Ser³-ghrelin(1-5)-NH₂45 μM0.16×Lower (ester linkage)
Oct-[Dap³]-ghrelin(1-5)-NH₂1 μMHigher (amide linkage)
  • Increased residence time in the active site due to resistance to hydrolysis likely contributes to the enhanced potency of amide-linked inhibitors

  • GOAT may recognize both the incoming peptide substrate and the acylated product, with the latter serving as an end-product inhibitor

  • The enzyme appears to have evolved to accommodate a less stable ester linkage, perhaps to facilitate product release and prevent strong end-product inhibition

These findings have significant implications for the design of GOAT inhibitors as research tools and potential therapeutics, suggesting that stabilized acyl-peptide mimetics represent a promising approach for developing potent inhibitors .

What is the molecular mechanism by which GOAT recognizes and acylates specific residues in ghrelin?

The molecular mechanism of GOAT's substrate recognition and acylation involves highly specific interactions with ghrelin's N-terminal sequence. Based on structure-activity studies and mutagenesis experiments, the following model has emerged:

Recognition sequence requirements:
GOAT demonstrates strict recognition of the N-terminal sequence of ghrelin, with particular emphasis on three conserved residues: glycine-1, serine-3, and phenylalanine-4. Alanine substitution at any of these positions dramatically reduces octanoylation efficiency both in vitro and in cell-based assays . This sequence specificity explains why these three amino acids are absolutely conserved in all vertebrate ghrelins.

N-terminal positioning:
The precise positioning of the N-terminus is critical for catalysis. Adding even a short N-terminal extension (two amino acids) to proghrelin markedly reduces octanoylation, demonstrating that GOAT requires access to the free N-terminal amine of glycine-1 . This suggests that the enzyme positions the substrate with the N-terminus anchored in a specific binding pocket.

Acylation site orientation:
The positioning of serine-3 in the active site places its hydroxyl group in proximity to the catalytic machinery and the octanoyl-CoA substrate. The surrounding amino acids, particularly phenylalanine-4, likely create a hydrophobic environment that favors interaction with the acyl chain.

Proposed catalytic sequence:

  • Binding of ghrelin N-terminus (GSSFL) in a specific recognition pocket

  • Coordination of octanoyl-CoA in proximity to serine-3

  • Deprotonation of the serine-3 hydroxyl by a catalytic histidine

  • Nucleophilic attack of the activated serine on the thioester carbonyl of octanoyl-CoA

  • Formation of the octanoyl-serine ester bond and release of CoA

This model explains GOAT's remarkable substrate specificity and provides a framework for understanding how modifications to the ghrelin sequence affect recognition and acylation efficiency .

How does the substitution of serine with diaminopropionic acid (Dap) affect GOAT inhibition and what does this reveal about the enzyme mechanism?

The substitution of serine-3 with diaminopropionic acid (Dap) in ghrelin peptides creates inhibitors with dramatically enhanced potency, revealing fundamental aspects of GOAT's catalytic mechanism and substrate interactions:

Enhanced inhibitory potency:
When the octanoyl group is attached to ghrelin through an amide linkage (using Dap) rather than the natural ester linkage (using Ser), inhibitory potency increases 35-45 fold . For example, octanoylated [Dap³]-ghrelin(1-28) achieves 50% inhibition at 0.2 μM compared to 7 μM for octanoylated wild-type ghrelin(1-28).

Mechanistic implications:

These findings not only provide insight into GOAT's catalytic mechanism but also establish a principle for designing more potent inhibitors by replacing the labile ester linkage with a stable amide bond . This approach may be applicable to other members of the MBOAT family as well.

What evidence supports the dual role of GOAT as both an acyltransferase and a cellular receptor for ghrelin?

Recent research has uncovered compelling evidence for GOAT's dual functionality as both an acyltransferase and a cellular receptor for ghrelin. This paradigm-shifting discovery expands our understanding of GOAT's biological roles:

Evidence for GOAT as a cell surface receptor:

  • Plasma membrane localization: GOAT has been detected at the plasma membrane in multiple cell types, positioning it to interact with extracellular ghrelin. This localization extends beyond its traditional view as an ER-resident enzyme .

  • Selective ligand binding: Using a tight-binding fluorescent ghrelin-derived peptide designed for high selectivity for GOAT over the ghrelin receptor GHS-R1a, researchers demonstrated that GOAT can bind extracellular ghrelin. This peptide was engineered to discriminate between GOAT and GHS-R1a, confirming the specificity of the interaction .

  • Facilitated internalization: GOAT facilitates ligand cell internalization in both transfected cells artificially expressing GOAT and prostate cancer cells that endogenously express the enzyme. This indicates a functional role in ghrelin trafficking across the plasma membrane .

  • Structure-activity relationship: The interaction between GOAT and extracellular ghrelin involves the same recognition elements identified for its acyltransferase activity, including interaction with the putative histidine general base within GOAT and the ghrelin peptide acylation site .

Biological implications:

This dual functionality suggests that GOAT may play roles beyond simply activating ghrelin through acylation. It may:

  • Serve as a cancer cell biomarker through GOAT-specific ligands coupled to imaging groups

  • Participate in ghrelin clearance or recycling from circulation

  • Enable re-acylation of deacylated ghrelin after cellular uptake

  • Transduce signals independent of the canonical ghrelin receptor

These findings raise the possibility that other peptide hormones may exhibit similar complexity in their intercellular and organismal-level signaling pathways, potentially representing a broader signaling paradigm in endocrinology .

How can fluorescent GOAT ligands be optimized for detecting GOAT expression in cancer cells?

Optimizing fluorescent GOAT ligands for cancer cell detection requires careful consideration of several factors to maximize specificity, sensitivity, and cellular uptake. Based on recent developments in fluorescent ghrelin analogs, the following optimization strategies are recommended:

Ligand design principles:

  • Selective binding: Engineer the peptide backbone to maximize GOAT binding while minimizing interaction with GHS-R1a. This can be achieved through parallel structure-activity analyses to identify modifications that differentially affect binding to these two proteins .

  • Fluorophore selection: Sulfo-Cy5 has proven effective for imaging GOAT-expressing cells, but other fluorophores with appropriate spectral properties may be considered based on the imaging platform. The fluorophore should be positioned to minimize interference with GOAT binding .

  • Linker optimization: The connection between the peptide and fluorophore should be optimized for stability and to prevent steric hindrance that might affect binding to GOAT.

  • Peptide length: The minimal GOAT-binding sequence (containing the N-terminal five amino acids of ghrelin) can be used as a starting point, but longer sequences may provide better specificity or cellular uptake properties .

Optimization table for fluorescent GOAT ligands:

Design ElementOptimization ApproachExpected Benefit
GOAT specificityReplace Ser³ with Dap³ + octanoylation35-45× increase in binding affinity
GHS-R1a discriminationN-terminal modificationsReduced GHS-R1a binding while preserving GOAT recognition
Cellular uptakeOptimized octanoyl chain lengthEnhanced membrane permeability and internalization
Signal-to-noise ratiopH-sensitive fluorophoresActivation upon internalization, reducing background

When applied to cancer detection, these optimized fluorescent ligands could serve as valuable tools for:

  • Diagnostic imaging of GOAT-expressing tumors

  • Fluorescence-guided surgery

  • Monitoring response to therapy

  • Patient stratification based on GOAT expression levels

This approach leverages GOAT's emerging role as a potential cancer biomarker while taking advantage of its dual functionality as both an enzyme and a cell-surface receptor for ghrelin .

What are the most promising approaches for developing GOAT inhibitors as potential anti-obesity therapeutics?

The development of GOAT inhibitors as anti-obesity therapeutics represents an attractive strategy for modulating ghrelin signaling. Based on current research, several approaches show particular promise:

Peptide-based inhibitors:
Peptide derivatives based on ghrelin's N-terminal sequence offer high potency and specificity. The most promising approach involves replacing serine-3 with diaminopropionic acid (Dap) and attaching an octanoyl group through an amide linkage. This modification increases inhibitory potency by 35-45 fold compared to the natural ester linkage . Further optimizations may include:

  • N-terminal capping to improve stability

  • Incorporation of non-natural amino acids to enhance pharmacokinetic properties

  • Cyclization strategies to improve bioavailability and stability

Small molecule inhibitors:
While less developed than peptide-based approaches, small molecule inhibitors offer potential advantages in bioavailability and manufacturing. Structure-based design strategies might include:

  • Mimetics of the octanoyl-CoA binding pocket

  • Compounds targeting the MBOAT catalytic machinery

  • Allosteric inhibitors that disrupt substrate binding

Bisubstrate inhibitors:
GO-CoA-Tat, a bisubstrate inhibitor developed by Barnett and colleagues, demonstrates selectivity for GOAT over GHS-R1a, presumably due to the inclusion of coenzyme A attached to the acyl side chain . This approach could be further refined to:

  • Reduce molecular weight while maintaining potency

  • Improve cellular penetration

  • Enhance metabolic stability

Therapeutic considerations for GOAT inhibitors:

ApproachAdvantagesChallengesDevelopment Status
Peptide-basedHigh potency & specificityLimited oral bioavailabilityMost advanced preclinical
Small moleculePotentially orally bioavailableLower specificityEarly discovery phase
BisubstrateDual targeting mechanismComplex synthesis, large sizeProof-of-concept established

For optimal therapeutic potential, GOAT inhibitors should:

  • Demonstrate high selectivity over other MBOAT family members

  • Show appropriate brain penetration (if central effects are desired)

  • Exhibit favorable pharmacokinetic profiles

  • Display minimal off-target effects

These approaches could lead to novel therapeutic options for obesity and related metabolic disorders by reducing levels of active acylated ghrelin and its orexigenic effects .

How might the cell-surface expression of GOAT create new opportunities for targeted drug delivery?

The discovery that GOAT is expressed on the cell surface and can facilitate ligand internalization opens exciting new avenues for targeted drug delivery systems. This feature can be exploited in several innovative ways:

GOAT-targeted drug delivery strategies:

  • Antibody-drug conjugates (ADCs): Antibodies specific to the extracellular domains of GOAT can be conjugated to cytotoxic payloads for selective delivery to GOAT-expressing cells, such as certain cancer types. This approach would leverage GOAT's apparent ability to facilitate internalization.

  • Peptide-drug conjugates: Ghrelin-derived peptides with high GOAT selectivity can be linked to therapeutic cargoes. The demonstrated ability of GOAT to facilitate uptake of fluorescent ghrelin analogs suggests that similar conjugates with drug payloads would also be internalized .

  • Nanoparticle targeting: Surface functionalization of nanoparticles with GOAT-specific ligands could enable targeted delivery of larger therapeutic payloads, including proteins or nucleic acids.

  • Theranostic applications: Combining imaging and therapeutic functions in a single GOAT-targeted molecule would allow for simultaneous diagnosis and treatment of conditions with aberrant GOAT expression.

Cellular targeting opportunities:

Research indicates that GOAT is expressed in prostate cancer cells and potentially other cancer types, making these prime targets for GOAT-directed drug delivery . Additionally, tissues known to express GOAT under normal conditions, such as the stomach, pancreas, and specific brain regions, could be selectively targeted for treating disorders affecting these tissues.

Potential advantages of GOAT-targeted delivery:

  • Selectivity: The high specificity of GOAT for ghrelin-derived peptides enables highly selective targeting

  • Internalization: GOAT-mediated uptake could enhance intracellular delivery of therapeutic agents

  • Reduced off-target effects: Targeted delivery would concentrate therapeutics at intended sites

  • Novel cancer targeting: May enable targeting of cancers resistant to current therapies

This approach represents a paradigm shift in how we can exploit GOAT biology, moving beyond simply inhibiting its enzymatic activity to utilizing it as a portal for selective drug delivery. Further research into the internalization mechanisms and trafficking pathways following GOAT-mediated uptake will be crucial for optimizing these delivery strategies .

What are the key unresolved questions regarding rat GOAT biology and catalytic mechanism?

Despite significant advances in understanding GOAT biology, several critical questions remain unresolved that represent important areas for future research:

Structural questions:

  • What is the three-dimensional structure of GOAT, and how does it accommodate both peptide and acyl-CoA substrates?

  • How does the enzyme coordinate the positioning of the catalytic histidine and the acylation site of ghrelin?

  • What conformational changes occur during catalysis, and how is product release regulated?

Mechanistic questions:

  • What is the precise catalytic mechanism, including the identity and role of all catalytic residues?

  • How does GOAT achieve selectivity for medium-chain acyl-CoAs, particularly octanoyl-CoA?

  • Is there a mechanism for direct transfer of dietary fatty acids to ghrelin without prior activation to acyl-CoA?

Cellular biology questions:

  • What is the trafficking pathway that delivers GOAT to the plasma membrane?

  • Does GOAT directly participate in signal transduction, or does it only facilitate ghrelin internalization?

  • What is the fate of ghrelin after GOAT-mediated internalization, and is there a recycling pathway?

Physiological questions:

  • Why is GOAT expressed in tissues that do not produce ghrelin, and what functions does it serve there?

  • Is there cross-talk between GOAT and the ghrelin receptor GHS-R1a signaling pathways?

  • Does GOAT interact with other peptide hormones besides ghrelin?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and physiology. Resolution of these issues will significantly advance our understanding of this unique enzyme and may reveal new therapeutic opportunities .

How can emerging technologies be applied to advance our understanding of GOAT structure and function?

Emerging technologies across multiple disciplines offer promising approaches to address the remaining challenges in GOAT research:

Structural biology innovations:

  • Cryo-electron microscopy (cryo-EM): Recent advances in single-particle cryo-EM have revolutionized membrane protein structural biology, potentially enabling determination of GOAT's structure without crystallization. This could reveal the first detailed view of GOAT's active site and substrate binding pockets.

  • Integrative structural approaches: Combining multiple techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS), cross-linking mass spectrometry (XL-MS), and computational modeling could provide structural insights even in the absence of high-resolution structures.

  • AlphaFold and related AI approaches: Deep learning algorithms for protein structure prediction have shown remarkable accuracy for membrane proteins and could generate valuable structural models of GOAT to guide experimental design.

Functional genomics and cellular imaging:

  • CRISPR-Cas9 genome editing: Creation of precise mutations in endogenous GOAT can provide insights into structure-function relationships in physiologically relevant contexts.

  • Super-resolution microscopy: Techniques such as STORM and PALM could reveal the subcellular distribution of GOAT with unprecedented detail, clarifying its trafficking patterns and membrane localization.

  • Proximity labeling approaches: BioID or APEX2 fusions with GOAT could identify proximal proteins, revealing potential interacting partners and regulatory factors.

Chemical biology and proteomics:

  • Activity-based protein profiling (ABPP): Development of activity-based probes for GOAT could enable monitoring of its enzymatic activity in complex biological samples.

  • Click chemistry approaches: Bioorthogonal chemistry could be used to track acyl transfer dynamics and substrate interactions in living cells.

  • Targeted proteomics: Development of sensitive MS methods for detection and quantification of GOAT and its various post-translational modifications could reveal regulatory mechanisms.

Application of these technologies, particularly in combination, promises to overcome many of the technical challenges that have limited our understanding of GOAT biology and could catalyze rapid advances in this field over the coming years .

What are the broader implications of GOAT research for understanding other membrane-bound O-acyltransferases (MBOATs)?

Research on GOAT provides a valuable model system for understanding the broader MBOAT family, with implications that extend well beyond ghrelin biology:

Mechanistic insights applicable to other MBOATs:
The finding that substitution of the hydroxyl acylation site with an amine dramatically increases inhibitor potency may represent a family-wide strategy for generating potent MBOAT inhibitors. This simple atomic substitution could facilitate identification of catalytic interactions in other MBOAT enzymes . Other MBOATs that might benefit from this approach include:

  • PORCN (Porcupine): Responsible for Wnt acylation and implicated in cancer

  • HHAT (Hedgehog acyltransferase): Mediates Hedgehog protein palmitoylation

  • DGAT1: Involved in triglyceride synthesis and metabolic disorders

Structural framework for the MBOAT family:
GOAT research is gradually revealing the structural determinants of substrate recognition and catalysis, which likely share common features across the MBOAT family. The identification of critical residues such as the histidine general base provides a framework for understanding conserved catalytic machinery .

Dual functionality hypothesis:
The discovery that GOAT can function both as an acyltransferase and as a cell-surface receptor raises the intriguing possibility that other MBOATs might also have dual functions. This could fundamentally change our understanding of how these enzymes contribute to cellular physiology and intercellular communication .

Therapeutic implications beyond ghrelin biology:
Insights from GOAT inhibitor development could inform therapeutic strategies targeting other MBOATs involved in disease processes:

MBOAT Family MemberPhysiological RoleDisease AssociationPotential Therapeutic Application
GOAT (MBOAT4)Ghrelin acylationObesity, cachexiaAppetite modulation
PORCNWnt acylationCancerWnt pathway inhibition
HHATHedgehog acylationCancer, developmental disordersHedgehog pathway modulation
DGAT1Triglyceride synthesisMetabolic disordersLipid metabolism regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.