Recombinant Rat Glucagon-like peptide 2 receptor (Glp2r)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice shipment is preferred, please inform us in advance and be aware of additional fees.
Notes
Avoid repeated freezing and thawing. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliqouting is recommended for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
Glp2r; Glucagon-like peptide 2 receptor; GLP-2 receptor; GLP-2-R; GLP-2R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MRPQPSPAVPSRCREAPVPRVRAQPVGIPEAQGPVPLHSQQMRLLWGPGRPFLALLLLVS IKQVTGSLLKETTQKWANYKEKCLEDLHNRLSGIFCNGTFDRYVCWPHSYPGNVSVPCPS YLPWWNAESPGRAYRHCLAQGTWQTRENTTDIWQDESECSENHSFRQNVDHYALLYTLQL MYTVGYSVSLISLFLALTLFLFLRKLHCTRNYIHMNLFASFILKVLAVLVKDMVSHNSYS KRPDDESGWMSYLSETSVSCRSVQVLLHYFVGTNHLWLLVEGLYLHTLLEPTVFPERRLW PKYLVVGWAFPMLFVIPWGFARAHLENTRCWATNGNLKIWWIIRGPMLLCVTVNFFIFLK ILKLLISKLKAHQMCFRDYKYRLAKSTLLLIPLLGVHEVLFTFFPDDQVQGFSKRIRLFI QLTLSSVHGFLVALQYGFANGEVKAELRKSWGRFLLARHWGCRTCVLGKNFRFLGKCSKK LSEGDGSETLQKLRFSTCSSHLASETLGDVGVQPHRGRGAWPRGSSLSESSEGDFTLANT MEEILEESEI
Uniprot No.

Target Background

Function
This receptor serves as a receptor for glucagon-like peptide 2. Its activity is mediated by G proteins, which subsequently activate adenylyl cyclase.
Gene References Into Functions
  1. GLP2R expression in the rat jejunum was quantified using quantitative real time PCR. PMID: 25748021
  2. Activation of the endogenous rat mucosal GLP-2 receptor was found to be linked to the activation of a cAMP/protein kinase A-dependent, growth-promoting pathway in vitro. PMID: 12960094
  3. The presence of a functional GLP-2-GLP-2R axis was confirmed in the developing rodent brain. PMID: 15059959
  4. GLP-2 acts within the gut by activating receptors on subepithelial myofibroblasts, leading to the release of growth factors that stimulate intestinal growth. PMID: 15544847
  5. Normal levels of polyamines were found to be essential for the expression of GLP-2-induced hyperplasia. PMID: 16274854
  6. GLP-2R was demonstrated to be expressed by vagal afferents, and intraperitoneal GLP-2 activates the vagal afferent pathway. PMID: 17234710
  7. Glucagon-like peptide 2 was shown to stimulate glucagon secretion through GLP-2r present on the alpha cell in rats. PMID: 17676310

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the tissue distribution pattern of Glp2r in rats?

Glp2r shows tissue-specific expression with highest levels detected in the jejunum, followed by duodenum, ileum, colon, stomach, and specific brain regions. In the central nervous system, Glp2r mRNA is expressed in the hypothalamus (particularly the arcuate nucleus [ARC] and dorsomedial nucleus [DMH]), hippocampus, and brainstem (dorsal motor nucleus of vagus [DMV] and parabrachial nucleus [PBN]) . Primary cultured rat astrocytes also express Glp2r . In the rat intestine, Glp2r expression is developmentally regulated, with higher levels in fetal and early neonatal life that decline toward postnatal levels with weaning .

How can researchers validate Glp2r expression in their experimental models?

Validation of Glp2r expression requires multiple complementary approaches:

The detection challenge is significant as Glp2r is often expressed at low levels, requiring sensitive methods. For example, in human islets, all samples exhibited low but reliable expression of GLP2R (Ct 30-35), with expression levels relative to housekeeping gene PPIA ranging from 0.00009 to 0.00226 .

What are the key genetic models available for studying Glp2r function?

Several genetic models have been developed to study tissue-specific functions of Glp2r:

  • Global Glp2r knockout mice: Generated by conventional gene targeting strategies .

  • Conditional Glp2r knockout models: Created using the Cre/loxP system.

    • Generation method: A BAC recombineering technique was used to create a Glp2r-targeting construct with loxP sites flanking exon 2 of the Glp2r gene . The construct typically includes:

      • 4.8-kb left arm and 5.3-kb right arm for homologous recombination

      • 0.5-kb DNA fragment containing the targeted exon 2 with partial introns

  • Tissue-specific Glp2r knockouts: Examples include:

    • POMC-Glp2r KO mice: Generated by crossing Glp2r^flox/flox mice with POMC-Cre transgenic mice to delete Glp2r specifically in POMC neurons .

    • Genotyping strategy: PCR using primers that detect the floxed allele (1496-bp), wild-type allele (1219-bp), and deleted allele (815-bp) .

  • Glp2r-expressing cell lines: Recombinant expression systems provide controllable models for studying Glp2r signaling mechanisms .

How can researchers distinguish between direct and indirect effects of GLP-2 on target tissues?

This requires a multi-faceted approach:

  • Tissue-specific knockouts: Compare phenotypes between global and tissue-specific Glp2r knockouts to delineate primary versus secondary effects.

  • Ex vivo studies: Isolate specific cell types (e.g., hepatic stellate cells) and test GLP-2 responses directly .

  • Antagonist studies: Use GLP-2(3-33) as a competitive antagonist to block Glp2r signaling .

  • Signaling pathway inhibitors: Apply specific inhibitors to determine which pathways are activated by GLP-2 in target cells.

Data from POMC-Glp2r KO mice demonstrate that the deletion of Glp2r in POMC neurons leads to hyperphagic behavior, accelerated gastric emptying, glucose intolerance, and hepatic insulin resistance, suggesting direct effects of GLP-2 on these neurons .

How does Glp2r signaling in the central nervous system regulate energy homeostasis?

Glp2r in POMC neurons plays a critical role in regulating multiple aspects of energy homeostasis:

  • Feeding behavior: POMC-Glp2r KO mice display hyperphagic behavior (increased food intake) and late-onset obesity, indicating that CNS GLP-2 signaling suppresses appetite .

  • Gastric motility: Glp2r in POMC neurons regulates gastric emptying. POMC-Glp2r KO mice show accelerated gastric emptying measured by 13C-octanoic acid breath test, with dramatically shorter half-excretion time (T1/2) and lag phase (Tlag) for liquid meals .

  • Glucose homeostasis: Intracerebroventricular infusion of GLP-2 augments glucose tolerance, suppresses glucose production, and enhances insulin sensitivity through mechanisms requiring PI3K (p110α) activation in POMC neurons .

ParameterWild-type micePOMC-Glp2r KO mice% Change
Glucose infusion rateNormalDecreased by 26.6%-26.6%
Hepatic glucose productionNormalIncreased by 47.5%+47.5%
Glucose uptake (Rd)NormalNo significant change-

These findings indicate that central Glp2r signaling regulates hepatic glucose production without significantly affecting peripheral glucose uptake .

What is the role of Glp2r in hepatic function and inflammation?

Glp2r expression in the liver is primarily localized to hepatic stellate cells (HSCs) rather than hepatocytes . This has important implications:

  • Hepatic steatosis: Glp2r^-/- mice exhibit increased hepatic lipid accumulation when challenged with high-fat diets .

  • Inflammation: Glp2r^-/- mice show upregulation of hepatic inflammatory biomarkers, with higher mRNA levels for Crp, Cxcr2, and Pkr compared to wild-type mice .

  • Stellate cell activation: Loss of Glp2r signaling increases markers of HSC activation and fibrosis, suggesting that GLP-2 normally suppresses HSC activation .

This creates a gut-liver axis where nutrient-stimulated GLP-2 secretion from intestinal L-cells may directly modulate hepatic stellate cell function, potentially protecting against inflammation and fibrosis .

How is Glp2r expression regulated under physiological and pathological conditions?

Multiple factors regulate Glp2r expression:

  • Glucose: Glp2r mRNA expression in rat astrocytes is modulated by glucose concentration in a dose-dependent manner. Maximum expression was observed with 17.5 mM glucose (2.3 times higher than with 1.4 mM) .

  • Inflammatory mediators: Pro-inflammatory conditions significantly downregulate Glp2r expression:

    • IL-1β/IFN-γ cytokine mix reduces Glp2r mRNA in human islets

    • LPS treatment markedly reduces Glp2r expression

  • Growth factors: Different growth factors have time-dependent effects on Glp2r expression:

    • PDGF induces a 45% increase at 30 minutes but a 40% decrease at 18 hours of incubation

    • IGF-2 and NGF increase Glp2r mRNA levels in short-term treatment

    • EGF plus GLP-2 increases expression after 18 hours

  • Hormones: Leptin and NPY inhibit Glp2r expression when glucose concentration is low .

This complex regulation suggests that Glp2r expression adapts to metabolic and inflammatory states, potentially explaining some discrepancies in experimental outcomes.

What signaling pathways are activated by GLP-2/Glp2r interaction in different tissues?

GLP-2 activates multiple signaling pathways depending on the cellular context:

  • In POMC neurons:

    • PI3K-Akt-FoxO1 signaling pathway via Glp2r-p85α interaction

    • Differential modulation of postsynaptic membrane excitability in a PI3K-dependent manner

  • In intestinal and BHK-GLP-2R cells:

    • Increases in cAMP and activation of PKA

    • Activation of phosphatidylinositol-3-kinase (PI3K)

    • Stimulation of mitogen-activated protein kinase (MAPK)

    • Increased CRE and AP-1-dependent transcription

    • Induction of immediate early c-fos and c-jun gene expression

  • In hepatic stellate cells:

    • Direct modulation of gene expression related to activation and fibrotic transformation

The activation of these pathways contributes to the diverse physiological effects of GLP-2, including growth promotion, anti-apoptosis, and metabolic regulation.

What strategies can overcome the short half-life of GLP-2 in experimental systems?

GLP-2 is rapidly degraded by dipeptidyl peptidase IV (DPP-IV), limiting its bioactivity. Several approaches can address this limitation:

  • DPP-IV-resistant analogs: Synthetic GLP-2 analogs with amino acid substitutions at position 2 (e.g., r[Gly²]GLP-2) are resistant to DPP-IV cleavage and show increased bioactivity in vivo . This analog substitutes the alanine at position 2 with glycine.

  • DPP-IV inhibition: Pharmacological inhibition of DPP-IV (e.g., with linagliptin) increases the half-life of endogenous GLP-2 .

  • Genetic models: Using DPP-IV-deficient rats enhances GLP-2 bioactivity, allowing for better assessment of physiological actions .

  • Teduglutide: A GLP-2 analog with increased stability that maintains biological activity and is used in both experimental models and clinical applications .

  • Recombinant expression systems: GLP-2-expressing Saccharomyces cerevisiae (GLP2-SC) provides continuous delivery of GLP-2, enhancing intestinal development in weaned rats .

The choice of approach depends on the specific research question and experimental system. In vitro studies may use direct application of GLP-2 analogs, while in vivo studies might benefit from DPP-IV inhibition or engineered delivery systems.

What techniques are most effective for measuring GLP-2-induced functional responses?

Functional readouts for GLP-2/Glp2r activity include:

  • Metabolic clamp studies: Hyperinsulinemic-euglycemic clamps can assess insulin sensitivity and hepatic glucose production in Glp2r knockout or GLP-2-treated animals .

  • Gastric emptying tests: 13C-octanoic acid breath test measures half-excretion time (T1/2), lag phase (Tlag), and gastric emptying coefficient .

  • Ex vivo tissue analysis:

    • Intestinal morphometry (villus height, crypt depth)

    • Protein and DNA content in intestinal tissue

    • Digestive enzyme activities in the jejunum

  • Cellular assays:

    • Cell proliferation assays using BrdU incorporation

    • Apoptosis assessment (caspase activity, TUNEL)

    • Electrophysiology for neuronal activity measurements

  • Active GLP-2 detection: Luminex-based assays can detect active GLP-2 with a detection limit of 20 pg/ml and minimal cross-reactivity to GLP-1 .

When designing experiments, it's important to include appropriate controls such as:

  • GLP-2(3-33) as a competitive antagonist

  • Vehicle controls

  • Wild-type littermates when using genetic models

  • Appropriate time points to capture both acute and chronic effects

How can researchers resolve contradictory findings in Glp2r research across different species and experimental models?

Several factors contribute to discrepancies in Glp2r research:

  • Species-specific differences: The intestinotrophic activity of GLP-2 varies between species due to differences in DPP-IV activity. GLP-2 is highly intestinotrophic in mice but shows reduced activity in rats due to faster inactivation .

  • Expression heterogeneity: Glp2r expression varies by tissue, developmental stage, and pathophysiological state. For example, Glp2r mRNA is expressed at high levels in fetal and early neonatal rat intestine but declines with weaning .

  • Experimental design variations:

    • Different doses and administration routes

    • Acute versus chronic treatments

    • Use of different GLP-2 analogs or delivery methods

    • Varying assessment endpoints

  • Methods sensitivity: Glp2r is often expressed at low levels, challenging detection limits of standard methods. In human islets, GLP2R mRNA levels relative to housekeeping genes range from 0.00009 to 0.00226, requiring sensitive RT-PCR methods .

To address these discrepancies, researchers should:

  • Carefully report experimental conditions

  • Use multiple complementary approaches

  • Consider species-specific factors

  • Include appropriate controls (e.g., GLP-2(3-33) antagonist)

  • Validate findings across different model systems

What are the critical methodological considerations when generating and characterizing recombinant rat Glp2r for research applications?

Producing functional recombinant rat Glp2r requires attention to several key factors:

  • Expression system selection:

    • Mammalian cell systems (HEK-293) better preserve native structure and post-translational modifications

    • E. coli systems may provide higher yields but risk improper folding of this seven-transmembrane receptor

    • Cell-free protein synthesis offers another alternative for specific applications

  • Protein purification strategies:

    • Inclusion of affinity tags (His, GST, or Strep) facilitates purification

    • Consideration of tag position to minimize interference with function

    • Membrane protein solubilization methods appropriate for GPCRs

  • Functional validation:

    • Ligand binding assays

    • G-protein coupling assessment

    • Signaling pathway activation (cAMP production, calcium mobilization)

  • Quality control parameters:

    • SDS-PAGE and Western blotting for purity assessment (>70-80% purity recommended)

    • Analytical SEC (HPLC) for aggregation analysis

    • Thermal stability assays

  • Storage considerations:

    • Stability in various buffer conditions

    • Freeze-thaw cycle tolerance

    • Long-term storage at -20°C or -80°C

When working with recombinant rat Glp2r, researchers should document all validation steps and include appropriate positive and negative controls in functional assays to ensure the recombinant protein accurately represents native receptor properties.

What are the emerging areas of Glp2r research that remain underexplored?

Several promising research directions merit further investigation:

  • Glp2r in neural circuits beyond POMC neurons: While Glp2r in POMC neurons has been characterized, its role in other neural populations remains unclear. Investigating Glp2r in different hypothalamic and brainstem neurons could reveal additional metabolic regulatory mechanisms .

  • Glp2r in astrocytes and neuroinflammation: Given that astrocytes express Glp2r and LPS reduces astrocyte viability in a manner reversible by GLP-2, exploring the role of Glp2r in neuroinflammation and neuroprotection represents an important avenue for research .

  • Interactions between Glp2r and other metabolic signaling pathways: Further research into how Glp2r signaling interacts with insulin, leptin, and nutrient-sensing pathways could uncover new therapeutic targets for metabolic disorders .

  • Quantifying the contribution of Glp2r to glucose homeostasis: Determining the extent to which GLP-2 can normalize glycemia under insulin and leptin resistance conditions would clarify its therapeutic potential .

  • Development of functional GLP-2R antagonists: These tools would enable more detailed mechanistic studies of the physiological roles of Glp2r .

These research directions could significantly advance our understanding of Glp2r biology and potentially reveal new therapeutic applications beyond current intestinal indications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.