Recombinant Rat Glucagon receptor (Gcgr)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Glucagon Receptor (Gcgr)

The recombinant rat glucagon receptor (Gcgr) is a genetically engineered protein used to study the molecular mechanisms of glucagon signaling and its role in glucose homeostasis. As a class B1 G protein-coupled receptor (GPCR), it regulates hepatic glucose production, gluconeogenesis, and glycogenolysis through interactions with glucagon, a peptide hormone critical for fasting glucose regulation . The recombinant form is produced via heterologous expression systems, such as HEK-293 cells or insect cells, to enable structural, functional, and therapeutic studies .

Signaling Pathways

Gcgr activation triggers:

  1. Gs-protein coupling, increasing cAMP and phosphorylating CREB at Ser133 .

  2. β-arrestin recruitment, which may modulate receptor internalization and alternative signaling .

  3. Cross-talk with insulin signaling, influencing glucose uptake and storage .

Expression Systems

Recombinant Gcgr is commonly produced in:

  • HEK-293 cells: High yields with post-translational modifications (e.g., glycosylation) .

  • Insect cells: Baculovirus-mediated expression for structural studies .

Tags and Purification

TagPurposeYield/Quality
Fc (human IgG1)Enhances solubility; facilitates purification via Protein A affinity chromatography .~39.5 kDa MW; migrates as 50–65 kDa on SDS-PAGE due to glycosylation .
His-tagPurification via metal affinity chromatography.High purity; used in crystallization studies .

Characterization

  • SDS-PAGE: Confirms molecular weight and glycosylation status .

  • Western blot: Validates expression and post-translational modifications .

  • Crystallization: Achieved for ECD bound to inhibitory antibodies (e.g., mAb1) .

ECD-Mediated Regulation

  • Negative regulation: The ECD stabilizes the inactive state; mutations (e.g., Y65A) increase basal activity .

  • Antibody interactions:

    • mAb1: Blocks glucagon binding by occupying the ECD cleft .

    • mAb23: Acts as an inverse agonist, enhancing α-cell hypersecretion in GCGR-KO models .

Ubiquitination and Signaling

  • K333R mutation: Reduces Gs coupling (6-fold EC50 increase) and enhances β-arrestin recruitment .

  • 5KR mutant: Shows 3-fold reduced cAMP production and CREB phosphorylation .

Overexpression in β-Cells

  • RIP-Gcgr mice: Exhibit increased insulin secretion, β-cell mass, and improved glucose tolerance under high-fat diets .

Diabetes and Obesity Models

  • GCGR-KO mice: Demonstrate α-cell hyperplasia, hyperglucagonemia, and improved glucose tolerance .

  • VGF regulation: In GCGR-KO α-cells, VGF upregulation drives glucagon secretion and granule maturation .

Drug Development

  • Antagonists: Target ECD (e.g., mAb1) or TMDs to inhibit glucagon signaling .

  • Agnomelatine analogs: Dual GLP-1/GCGR agonists (e.g., DR10601) for glycemic control and weight loss .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquotting is crucial. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gcgr; Glucagon receptor; GL-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-485
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYL PWYHKVQHRLVFKRCGPDGQWVRGPRGQSWRDASQCQMDDDEIEVQKGVAKMYSSYQVMY TVGYSLSLGALLLALVILLGLRKLHCTRNYIHGNLFASFVLKAGSVLVIDWLLKTRYSQK IGDDLSVSVWLSDGAVAGCRVATVIMQYGIIANYCWLLVEGVYLYSLLSITTFSEKSFFS LYLCIGWGSPLLFVIPWVVVKCLFENVQCWTSNDNMGFWWILRIPVLLAILINFFIFVRI IHLLVAKLRAHQMHYADYKFRLARSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSTKLFFD LFFSSFQGLLVAVLYCFLNKEVQAELLRRWRRWQEGKALQEERMASSHGSHMAPAGTCHG DPCEKLQLMSAGSSSGTGCEPSAKTSLASSLPRLADSPT
Uniprot No.

Target Background

Function
The glucagon receptor, a G-protein coupled receptor, plays a pivotal role in regulating blood glucose levels and maintaining glucose homeostasis. It modulates hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis, thereby contributing significantly to the body's response to fasting. Glucagon binding induces a conformational change, initiating signaling through guanine nucleotide-binding proteins (G proteins). This, in turn, influences the activity of downstream effectors such as adenylate cyclase. The receptor promotes activation of adenylate cyclase. Additionally, it participates in signaling through a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Glucagon-induced vasodilatation occurs not only through the glucagon receptor but also via the GLP-1 receptor, and it is independent of the endothelium. PMID: 26975347
  2. Following exercise and fasting, GluR density (mRNA and proteins) is significantly higher compared to the control group. PMID: 23918690
  3. The Gln(3) residue of glucagon does not interact with the same binding pocket as the Asp(3) residue of vasoactive intestinal peptide or secretin. PMID: 11853547
  4. A proposed model for glucagon receptor activation suggests that glucagon initially interacts with the receptor's N-terminal domain, followed by more specific interactions between the N-terminal half of the peptide and the first extracellular loop of the receptor. PMID: 12269822
  5. Glucagon-mediated responses were unaffected by the GLP-1 receptor antagonist exendin-(9-39) but abolished by des-His1-[Glu9]-glucagon-amide, a specific glucagon receptor blocker. PMID: 15459251
  6. Feeding a high-fat diet is associated with a reduction in plasma membrane hepatic glucagon receptor density and G(s)alpha protein content, a phenomenon not mitigated by a 30-minute exercise bout. PMID: 15687107
  7. Following glucagon-mediated internalization of the serine-phosphorylated glucagon receptor and the Gsalpha protein within hepatic target cells, extended signal transduction may occur in vivo at the endo-lysosomal apparatus. PMID: 17010343
  8. High-fat diet-induced obesity is linked to desensitization and destruction of the hepatic GR. PMID: 17053032
  9. These findings indicate that glucagon stimulates the acute release of both forms of ghrelin and subsequently upregulates the synthesis and release of desacyl-ghrelin in the rat stomach. PMID: 17462598
  10. The actin cytoskeleton, beta-arrestin1, beta-arrestin2, and the glucagon receptor's carboxyl terminus are involved in its recycling. PMID: 18787074

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the glucagon receptor (GCGR) and what is its fundamental role in glucose homeostasis?

The glucagon receptor plays a fundamental role as a regulator of glucose homeostasis. When plasma glucagon levels increase, this results in increased glucose production and maintenance of blood glucose levels. This mechanism is particularly important during fasting states. Genetic and pharmacologic inhibition of glucagon signaling leads to lowering of fasting plasma glucose concentrations by approximately 1–2 mmol/L in both mice and humans . This underscores the critical role that glucagon plays in maintaining glucose homeostasis, particularly during fasting conditions rather than postprandially. Interestingly, administration of a glucagon receptor antagonist (GRA) does not significantly affect postprandial glucose excursions in patients with type 2 diabetes, further supporting the notion that glucagon's primary role in glucose regulation occurs during fasting states .

What signaling pathways are activated by the glucagon receptor?

The glucagon receptor activates multiple signaling pathways, with the adenylyl cyclase pathway being the primary mechanism. This activation leads to increased cAMP production, which triggers downstream effects on glucose and lipid metabolism. Studies examining the related GLP-1 receptor have established that a single receptor species can mediate effects through multiple signaling pathways, including both the adenylyl cyclase system and intracellular calcium release .

How is GCGR expression distributed across different tissues?

GCGR expression varies significantly across tissues, with highest expression in specific cell types. Using autoradiography with ¹²⁵I-labeled glucagon, researchers have demonstrated high receptor density in hepatocytes, which is consistent with the liver being the primary target organ for glucagon action . High receptor expression is also observed in the distal and collecting duct cells of the kidney. The specificity of this binding was confirmed by competition experiments using excess non-labeled glucagon, which abolished the signal .

Weaker GCGR expression is observed in the islets of Langerhans compared to surrounding exocrine tissue. Interestingly, while immunostaining studies suggest GCGR presence in the stomach, heart, and adrenal glands, autoradiography did not detect surface expression in these tissues, potentially indicating intracellular accumulation of non-functional GCGR protein . Neither immunostaining nor autoradiography detected GCGR in the small intestine, muscles, adipose tissue, or spleen .

What methodological approaches are recommended for detecting GCGR expression in tissues?

When studying GCGR expression, researchers should consider using complementary methods to ensure reliable results. A systematic evaluation of twelve commercially available GCGR antibodies revealed significant variability in specificity, with antibody no. 11 emerging as the most specific option . Western blotting using this antibody detected the expected ~55-62 kDa band in both human and mouse GCGR-expressing samples, with validation through comparative analysis of tissues from Gcgr⁺/⁺ and Gcgr⁻/⁻ mice .

For antibody-independent validation, autoradiography with ¹²⁵I-labeled glucagon represents a highly sensitive approach that depends on ligand-receptor binding. This method can effectively discriminate between specific GCGR binding and non-specific interactions when properly controlled with competition experiments using excess non-labeled glucagon . The complementary use of both antibody-based and autoradiography approaches provides the most comprehensive assessment of GCGR expression patterns across tissues.

How do GCGR agonists and antagonists affect glucose and lipid metabolism?

Regarding lipid metabolism, glucagon signaling appears to play a protective role against hepatic steatosis. Acute administration of glucagon (30 μg/kg) in mice resulted in decreased free fatty acid and triglyceride plasma concentrations, as well as reduced hepatic triglyceride content and secretion . Conversely, impaired glucagon signaling through genetic knockout or antagonist treatment leads to increased hepatic fat accumulation, as observed in both rats and diabetic mice . This appears to result from decreased beta-oxidation and increased lipogenesis, with studies showing downregulation of enzymes involved in beta-oxidation (e.g., CPT-1) and upregulation of genes involved in lipogenesis .

These findings highlight the complex interplay between glucagon's roles in glucose and lipid homeostasis, suggesting that targeted approaches that preserve glucagon's beneficial effects on lipid metabolism while modulating its glucose-raising effects might be particularly valuable therapeutically.

What are the latest approaches for developing dual GCGR/GLP-1R agonists?

Recent advances in machine learning have revolutionized the design of peptides with specific receptor activity profiles. Using a training set of 125 experimentally characterized glucagon and GLP-1 peptide analogues, researchers have developed computational models that capture the relationship between peptide sequence and receptor activation at both GCGR and GLP-1R . The most effective approach involved an ensemble of multi-task convolutional neural network models that simultaneously predict potency at both receptors .

The model performance was evaluated using root mean square error (RMSE) calculations across multiple model architectures:

ModelsCross-validation on training dataValidation on held-out literature data
RMSE GCGRRMSE GLP-1R
Ridge0.63 ± 0.060.75 ± 0.10
SVR0.60 ± 0.040.81 ± 0.07
GPR0.69 ± 0.170.88 ± 0.23
Random forest0.62 ± 0.040.77 ± 0.06
NN single-task0.67 ± 0.070.78 ± 0.07

Using this computational approach, researchers successfully designed 15 novel peptides with three distinct activity profiles: selective potency at GCGR, selective potency at GLP-1R, or high potency at both receptors . Experimental validation confirmed that three of the model-designed sequences are potent dual agonists with superior biological activity . This machine learning strategy represents a significant advancement in rational peptide design for targeting these receptors.

What experimental systems are available for studying recombinant rat GCGR signaling?

Several experimental systems have been developed for studying recombinant rat GCGR signaling. Researchers commonly use stable cell lines expressing the receptor of interest. For example, Chinese hamster ovary (CHO) cell lines stably expressing human, mouse, rat, or cynomolgus monkey GLP-1 or glucagon receptors have been generated at research institutions for comparative studies . These systems allow for controlled investigation of species-specific receptor properties.

For more physiologically relevant contexts, specialized cell lines like INS-1 832/3 (a rat insulinoma cell line) and EndoC-βH1 cells have been utilized . Additionally, the establishment of a stable pancreatic islet α-cell line expressing the recombinant rat GLP-1 receptor (INR1-SF2), derived from INR1-G9 cells that lack endogenous GLP-1 receptor expression, provides a valuable model for studying receptor signaling in a more native cellular environment .

In these systems, receptor activation can be measured through various readouts, with cyclic AMP (cAMP) accumulation assays being particularly common due to the coupling of both glucagon and GLP-1 receptors to the adenylyl cyclase pathway . Calcium mobilization assays provide additional insights into alternative signaling pathways activated by these receptors. Together, these experimental systems offer diverse platforms for investigating the complex signaling mechanisms of the glucagon receptor.

What are the key considerations when selecting antibodies for GCGR detection?

When selecting antibodies for GCGR detection, specificity validation is paramount. A systematic evaluation of commercially available antibodies demonstrated significant variability in specificity and reliability . Researchers should validate antibodies using multiple approaches, including:

  • Western blotting of cells transfected with human or mouse GCGR cDNA to confirm detection of bands at the predicted size (~62kDa)

  • Comparison of staining patterns in tissues from wild-type (Gcgr⁺/⁺) versus knockout (Gcgr⁻/⁻) animals

  • Verification with antibody-independent methods such as autoradiography with labeled ligands

  • Assessment of cross-reactivity with related receptors

Based on comprehensive evaluation, antibody no. 11 emerged as the most specific option among twelve tested antibodies, detecting the expected ~55kDa band corresponding to the antibody/GCGR receptor complex in liver tissue from Gcgr⁺/⁺ mice, with no signal in tissue from Gcgr⁻/⁻ mice . The selection of a properly validated antibody is essential for obtaining reliable results in GCGR research.

How should researchers approach the design of experiments studying GCGR/GLP-1R dual agonism?

When designing experiments to study GCGR/GLP-1R dual agonism, researchers should consider a multifaceted approach that accounts for the complex pharmacology of these receptors. Studies should incorporate:

  • Receptor binding assays to determine affinity for both GCGR and GLP-1R

  • Functional assays measuring multiple signaling pathways (e.g., cAMP accumulation, calcium mobilization)

  • Concentration-response curves to calculate EC₅₀ values and determine relative potency at each receptor

  • Assessment of potential biased signaling (preferential activation of specific pathways)

  • Comparison with selective receptor agonists as reference compounds

For cell-based assays, stable Chinese hamster ovary (CHO) cell lines expressing human, mouse, rat, or cynomolgus monkey receptors provide valuable tools for assessing species-specific differences in receptor pharmacology . When designing dual agonists, researchers should consider the peptide sequence carefully, as minor modifications can significantly alter the balance of activity between GCGR and GLP-1R .

Machine learning approaches represent a powerful strategy for optimizing dual agonist design, with multitask convolutional neural networks showing particular promise for simultaneously predicting potency at both receptors . This computational approach can significantly streamline the development process by prioritizing sequences most likely to exhibit the desired activity profile.

What are the advantages and challenges of targeting GCGR for metabolic disease treatment?

These adverse effects likely relate to glucagon's important role in lipid metabolism. Glucagon administration decreases free fatty acid and triglyceride plasma concentrations, reduces hepatic triglyceride content and secretion, and appears to stimulate beta-oxidation . Inhibiting these beneficial effects on lipid metabolism may explain the increased hepatic steatosis observed with GCGR antagonism.

Conversely, GCGR agonism or co-agonism with GLP-1R activation represents an alternative therapeutic strategy. Co-infusion of glucagon and GLP-1 in overweight humans resulted in greater decreases in food intake compared to GLP-1 alone, without inducing hyperglycemia . Preclinical studies with glucagon/GLP-1 receptor co-agonists in type 2 diabetic and obese rodents demonstrated reduced hepatic steatosis, increased hormone-sensitive lipase activity in adipocytes, and improved dyslipidemia .

These findings suggest that balanced modulation of glucagon signaling, particularly in combination with GLP-1R activation, may offer a more favorable approach for treating metabolic disorders by leveraging glucagon's beneficial effects on lipid metabolism while mitigating its glucose-raising effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.