Recombinant Rat Glucose-dependent insulinotropic receptor (Gpr119)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr119; Glucose-dependent insulinotropic receptor; G-protein coupled receptor 119
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-468
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL VAGGCIAGLWLISYLIGFLPLGVSIFQQTTYHGPCTFFAVFHPRFVLTLSCAGFFPAVLL FVFFYCDMLKIASVHSQHIRKMEHAGAMVGACRPPRPVNDFKAVRTVSVLIGSFTLSWSP FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLCHMALGLLAD GSTQPQIETLKGKEERKKVGRKTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDACDTQTLY TCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDTQTLYTCDAQTLYTCDA QTLYTCDAQTLYTCDAQTLYTSSLVTGQTEQTPLKRANMSDPLRTCRG
Uniprot No.

Target Background

Function
This receptor acts as a receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). It also functions as a glucose-dependent insulinotropic receptor. The receptor's activity is mediated by G proteins, which activate adenylate cyclase. It appears to operate through a G(s) mediated pathway.
Gene References Into Functions
  1. Cells treated with Angelica dahurica extract exhibited significant increases in GPR119 activation, intracellular cAMP levels, GLP-1 levels, and glucose-stimulated insulin secretion compared to controls. PMID: 27391814
  2. Pathways activated in response to GPR119 modulation in cardiac muscle cells differ between healthy and metabolically dysregulated states. PMID: 25578601
  3. Research indicates that functional GPR119 responses are similar in lean and diabetic rodent and human colon models. Notably, GPR119 stimulation can lead to glucose lowering through the release of intestinal peptide hormones. PMID: 24451185
  4. Findings suggest that GPR119 activation/up-regulation in skeletal muscle impairs fatty acid and glucose oxidation. Notably, diet-induced obesity appears to up-regulate skeletal muscle GPR119. PMID: 23069642
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expression restricted to the beta-cells of pancreatic islets.

Q&A

What is GPR119 and where is it primarily expressed in rat models?

GPR119 is a cannabinoid receptor-like class A G protein-coupled receptor highly expressed in pancreatic β cells and intestinal enteroendocrine L cells. In rat models, GPR119 plays critical roles in glucose homeostasis and feeding behavior, making it relevant for metabolic disorder research. The receptor primarily couples to Gs proteins to activate adenylate cyclase and cyclic AMP signaling pathways .

Similar to humans, rat GPR119 consists of seven transmembrane helices connected by three extracellular regions and intracellular regions, with homologous proteins found across various vertebrates including zebrafish and monkeys . When studying rat GPR119, it's essential to note that while there is high conservation across species, species-specific differences in ligand binding and signaling may exist.

How does recombinant rat GPR119 differ from native GPR119 in functional assays?

Recombinant rat GPR119 typically contains modifications such as epitope tags (e.g., FLAG, His, or Strep tags) that facilitate purification, detection, and characterization. These modifications can be introduced at the C-terminus of GPR119 without significantly altering its pharmacological properties .

When performing functional assays, researchers should consider:

  • Expression systems: Recombinant GPR119 is often expressed in heterologous systems like insect cells (e.g., High Five cells) or mammalian cell lines (HEK293, CHO cells)

  • Validation methods: Flow cytometry using fluorescently-labeled antibodies against epitope tags can verify surface expression

  • Pharmacological comparison: EC50 values for standard agonists should be determined for both native and recombinant receptors to ensure functionality remains comparable

Importantly, experiments with standard agonists should confirm that recombinant modifications do not alter the pharmacology of GPR119 . For optimal results, maintain consistent expression levels across experimental batches by using stable cell lines when possible.

What are the standard methods for verifying successful expression of recombinant rat GPR119?

Several complementary methods can verify successful recombinant rat GPR119 expression:

  • Flow cytometry: Using anti-Flag M2-fluorescein isothiocyanate antibodies (for Flag-tagged GPR119) to detect surface expression. Incubate cells with the antibody at 4°C for 20 minutes protected from light, then terminate the reaction with 1× TBS buffer before analysis .

  • Western blot analysis: Using antibodies against the epitope tag or against GPR119 directly to confirm expression of the full-length protein.

  • Functional assays: Measuring cAMP accumulation in response to known GPR119 agonists like AR231453, MBX-2982, or APD597 .

  • Binding assays: Using labeled ligands to confirm binding characteristics of the expressed receptor.

For quantitative analysis, establish a negative control using non-transfected cells to determine background signal. The expression level should be reported after deducting this background signal. Data should be collected from at least three independent experiments performed in triplicate to ensure reliability .

How do different agonists affect the conformational changes in recombinant rat GPR119, and what are the implications for signaling bias?

Different GPR119 agonists can induce distinct conformational changes that potentially lead to signaling bias. Structure-function studies using cryo-electron microscopy have revealed specific conformational changes associated with different agonists:

AgonistPrimary Conformational ChangesSignaling Pathway BiasStructural Implications
AR231453Significant outward movement of TM6, stabilization of R213-S219Strong Gs couplingForms hydrophobic interactions with conserved residues in TM3, TM5, and TM6
MBX-2982Moderate outward movement of TM6, distinct binding pocket engagementBalanced Gs activationInteracts with a hydrophobic cavity between TM4 and TM5
APD597Specific interactions with extracellular loop regionsPotentially biased signalingDemonstrates favorable balance between agonist potency and intrinsic activity

To investigate signaling bias:

  • Perform parallel assays measuring multiple downstream pathways (cAMP, ERK1/2 phosphorylation, β-arrestin recruitment)

  • Calculate bias factors using operational models of receptor activation

  • Correlate structural changes with pathway preference using mutagenesis of key residues identified in structural studies

Notable structural changes during activation include rearrangements of conserved motifs such as PIF, NPxxY, and DRY motifs, which are crucial for G protein coupling. Mutational studies targeting these regions can provide insights into how different agonists might preferentially activate distinct signaling pathways .

What are the critical considerations when designing experiments to study the pharmacokinetics of recombinant rat GPR119 agonists in hypoglycemia models?

When designing experiments to study GPR119 agonist pharmacokinetics in hypoglycemia models, researchers should consider:

Experimental Design Considerations:

  • Dosing regimen optimization:

    • Determine appropriate dosing based on agonist half-life and clearance rates

    • Consider whether single-dose or chronic administration is relevant for your hypothesis

    • Account for potential metabolite generation (e.g., APD597 has improved pharmacokinetics compared to APD668, which produces hydroxyl metabolites with extended half-lives)

  • Animal model selection:

    • Choose between healthy rats or streptozotocin (STZ)-induced diabetic rats

    • Consider models with impaired glucagon counterregulatory responses due to recurrent hypoglycemia

    • Include GPR119 knockout controls to confirm on-target effects

  • Hypoglycemia induction protocol:

    • Use insulin infusion hypoglycemic clamps with careful glucose monitoring

    • Standardize the hypoglycemia depth and duration

    • Account for study site differences (e.g., studies at MRL versus Yale University showed consistent results but with different experimental designs)

Critical Parameters to Measure:

ParameterMeasurement MethodSignificance
Plasma glucoseGlucose analyzer during clampTarget level of hypoglycemia
Glucagon levelsELISA/RIA at multiple timepointsPrimary outcome for counterregulation
Insulin levelsELISA/RIAConfirms hypoglycemia induction
Incretins (GLP-1, GIP)ELISASecondary outcome for incretin effect
Drug/metabolite levelsLC-MS/MSPharmacokinetic profile

To ensure reproducibility, standardize all procedures including anesthesia protocols, surgical techniques for catheterization, blood sampling volumes and frequency, and analytical methods. Independent validation across different laboratories strengthens findings, as demonstrated by the consistent results obtained at MRL and Yale University despite using different study designs and GPR119 agonists .

How does the structural biology of recombinant rat GPR119 inform the design of selective agonists with improved efficacy?

The structural biology of GPR119 provides crucial insights for rational drug design:

Key Structural Features for Agonist Design:

  • Unique transmembrane arrangement:

    • GPR119 contains a one-amino acid shift of the conserved proline residue in TM5 that forms an outward bulge

    • This creates a distinctive hydrophobic cavity between TM4 and TM5 that can be targeted for ligand selectivity

  • Critical binding pocket residues:

    • Hydrophobic interactions with residues in TM3, TM5, and TM6 are essential for agonist binding

    • The specific interaction pattern varies between chemically different agonists

    • Mutagenesis studies can confirm which residues are critical for binding versus activation

  • G protein coupling interface:

    • The salt bridge between ICL1 of GPR119 and Gβs is crucial for cAMP production

    • Disruption of this salt bridge eliminates cAMP production, highlighting its importance in signaling

Optimization Strategies Based on Structural Insights:

  • Structure-guided modifications to improve:

    • Binding affinity by enhancing interactions with key residues

    • Selectivity by targeting GPR119-specific structural features

    • Pharmacokinetic properties by modifying solvent-exposed regions

  • Comparative structural analysis of different agonists:

    • APD597 demonstrates improved solubility compared to its structural analog APD668

    • APD597 produces fewer hydroxyl metabolites with long half-lives, reducing drug-drug interactions

    • These differences can be explained by subtle structural variations that can be exploited in new compound design

For successful agonist design, researchers should employ iterative cycles of structure-based design, synthesis, and biological evaluation, focusing on optimizing the balance between agonist potency and intrinsic activity while maintaining favorable pharmacokinetic properties.

What are the optimal protocols for expressing and purifying recombinant rat GPR119 for structural studies?

Successful expression and purification of recombinant rat GPR119 for structural studies requires meticulous attention to protocol details:

Expression System Optimization:

  • Insect cell expression (recommended):

    • Use High Five cells (Invitrogen) with an insect expression system

    • Co-express GPR119 with Gαs and Gβ1γ2 for complex formation

    • Tag GPR119 with strep at the C-terminus and Gβ1 with a his tag

    • Express for 48 hours before harvesting cells by centrifugation

  • Bacterial expression for nanobodies:

    • Express Nb35 using pET-28a vector in E. coli

    • This nanobody is crucial for stabilizing the Gαs-Gβ1γ2 interface

Purification Strategy:

StepMethodCritical Parameters
1. Cell lysisSonicationMaintain 4°C, use protease inhibitors
2. Membrane preparationUltracentrifugation100,000×g, 1 hour, 4°C
3. SolubilizationDetergent extractionUse appropriate detergent (e.g., DDM/CHS)
4. Affinity purificationStrep-Tactin columnInclude agonist throughout purification
5. Size exclusionGel filtrationMonitor complex integrity

Complex Stabilization for Structural Studies:

  • Add antibody Nb35 to stabilize the Gαs protein

  • Include specific agonist (AR231453, MBX-2982, or APD597) throughout purification

  • Maintain agonist concentration above its EC50 value

  • Verify complex formation by SDS-PAGE and SEC-MALS

For cryo-EM studies, the final sample should be concentrated to 3-5 mg/mL and applied to glow-discharged grids. Vitrification conditions must be optimized for each preparation. The above approach has successfully yielded structures at resolutions of 2.8Å, allowing visualization of both receptor-ligand and receptor-G protein interfaces .

How can researchers effectively design experiments to analyze GPR119-mediated incretin release in rat models?

Designing robust experiments to analyze GPR119-mediated incretin release in rat models requires careful consideration of several key factors:

In Vivo Experimental Design:

  • Animal selection and preparation:

    • Use age-matched rats (8-12 weeks old)

    • Include appropriate controls: wild-type, GPR119 knockout, vehicle-treated

    • Fast animals for 8-12 hours before experiments to establish baseline

    • Consider both acute and chronic dosing regimens

  • Administration methods:

    • Oral gavage: Preferred for GPR119 agonists to capture the full incretin effect

    • Intraperitoneal injection: Useful for mechanistic studies

    • Dose-response relationships should be established (typically 3-5 doses)

  • Sampling protocol:

    • Collect blood at multiple timepoints (0, 15, 30, 60, 120 minutes post-administration)

    • Use DPP-IV inhibitors in collection tubes to prevent incretin degradation

    • Process samples immediately and store at -80°C

Ex Vivo Approaches:

  • Isolated perfused intestine:

    • Allows direct assessment of GLP-1 secretion from enteroendocrine L-cells

    • Maintain physiological conditions (37°C, appropriate oxygenation)

    • Collect perfusate at regular intervals after GPR119 agonist administration

  • Primary intestinal cell cultures:

    • Isolate and culture enteroendocrine cells from rat intestine

    • Verify cell identity with immunostaining for GLP-1

    • Measure incretin secretion after GPR119 agonist treatment

Analytical Methods:

IncretinMeasurement MethodSample ProcessingConsiderations
GLP-1ELISA (active form)Add DPP-IV inhibitorDistinguish between total and active GLP-1
GIPRadioimmunoassayAprotinin preservationMeasure at multiple timepoints
PYYMultiplex assayProtease inhibitor cocktailConsider measuring multiple gut hormones simultaneously

To ensure physiologically relevant results, researchers should correlate incretin release with functional outcomes such as insulin secretion and glucose tolerance. Using glucose-tolerance tests in conjunction with incretin measurements provides context for the significance of GPR119-mediated effects .

What are the most reliable techniques for evaluating potential off-target effects of GPR119 agonists in preclinical studies?

Evaluating off-target effects of GPR119 agonists requires a multi-faceted approach combining in vitro screening, in silico prediction, and in vivo validation:

In Vitro Screening Panel:

  • GPCR selectivity profiling:

    • Screen against a panel of related GPCRs, particularly cannabinoid and adenosine receptors (phylogenetically related to GPR119)

    • Test at concentrations 10-100× higher than the EC50 for GPR119

    • Use both binding assays and functional readouts

  • Non-GPCR target screening:

    • Evaluate binding to nuclear receptors, ion channels, and enzymes

    • Include major CYP enzymes to identify potential drug-drug interactions

    • Test for hERG channel inhibition to assess cardiac safety

  • Cell-based toxicity assays:

    • Perform MTT or ATP-based viability assays across multiple cell types

    • Include hepatocytes to evaluate potential hepatotoxicity

    • Assess mitochondrial function and oxidative stress markers

In Silico Approaches:

  • Computational modeling to predict:

    • Binding to off-target receptors based on structural similarities

    • ADME properties that might lead to accumulation in specific tissues

    • Structural alerts for toxicophores

  • Pharmacophore modeling comparing GPR119 agonists to known ligands of related receptors

In Vivo Validation Strategies:

AssessmentMethodologyTime PointsMarkers
CardiovascularTelemetry in conscious ratsContinuous for 24-48hHeart rate, blood pressure, ECG
HepaticSerum biochemistry, histopathologyBaseline, 24h, 7d, 28dALT, AST, bilirubin, histology
RenalUrine analysis, blood chemistryBaseline, 24h, 7d, 28dCreatinine, BUN, protein/creatinine ratio
CNSBehavioral testing, histopathologyVariousActivity, coordination, cognition

For GPR119 agonists specifically, pay particular attention to:

  • Metabolic parameters beyond intended effects (hypoglycemia, lipid changes)

  • Potential effects on food intake and body weight (GPR119 activation suppresses food intake)

  • Long-term effects from metabolite accumulation (particularly relevant for compounds like APD668 that produce hydroxyl metabolites with extended half-lives)

Comparative studies with different structural classes of GPR119 agonists can help distinguish target-based effects from compound-specific off-target effects, enhancing the reliability of safety assessments.

How should researchers interpret contradictory findings between in vitro and in vivo studies of recombinant rat GPR119 activation?

When facing contradictions between in vitro and in vivo GPR119 studies, systematic analysis is essential:

Common Sources of Discrepancies:

  • Pharmacokinetic considerations:

    • In vitro potency may not translate to in vivo efficacy due to poor absorption, distribution, metabolism, or excretion

    • Some GPR119 agonists have poor stability and solubility, affecting bioavailability

    • Metabolite formation may contribute to in vivo effects not predicted by in vitro testing

  • Physiological complexity:

    • GPR119 activation in vivo involves multiple organs and cell types

    • The dual mechanism of direct insulin secretion and incretin release creates complexity

    • Counterregulatory hormones present in vivo may modulate GPR119 effects

  • Experimental design limitations:

    • Differences in recombinant versus native receptor expression levels

    • Variations in glucose concentrations between assays (critical as effects are glucose-dependent)

    • Time-course differences between acute in vitro and sustained in vivo responses

Resolution Strategy Framework:

Discrepancy TypeInvestigation ApproachAnalysis Method
Potency differencesPK/PD studies with concentration measurement at target tissuesCorrelation of plasma/tissue levels with effect magnitude
Effect direction contradictionsIsolated perfused pancreas studies as intermediate complexityMultivariate analysis to identify confounding variables
Temporal pattern differencesTime-course studies with frequent samplingArea-under-curve analysis and compartmental modeling

Integrative Data Analysis Approaches:

  • Develop physiologically-based pharmacokinetic/pharmacodynamic (PBPK/PD) models that incorporate:

    • Tissue distribution of the agonist

    • Receptor expression levels across tissues

    • Temporal dynamics of direct and indirect effects

  • Use knockout or knockdown studies to isolate specific pathway contributions:

    • GPR119 KO mice studies have confirmed that increased glucagon secretion during hypoglycemia is an on-target effect of GPR119 agonists

    • Tissue-specific knockdowns can help dissect pancreatic versus intestinal contributions

  • Employ translational biomarkers measurable in both systems:

    • cAMP levels as a proximal signaling marker

    • Incretin hormone secretion as an intermediate marker

    • Insulin/glucagon levels as functional endpoints

When reporting discrepancies, researchers should explicitly discuss limitations of each model system and propose mechanistic explanations for contradictions rather than simply highlighting which system might be "more relevant."

What statistical approaches are most appropriate for analyzing dose-response relationships in GPR119 signaling studies?

Analyzing dose-response relationships in GPR119 signaling requires sophisticated statistical approaches tailored to the complexities of receptor pharmacology:

Recommended Statistical Models:

  • Nonlinear regression models:

    • Four-parameter logistic (4PL) model for standard sigmoid curves

    • Five-parameter logistic (5PL) model for asymmetric responses often seen with partial agonists

    • Operational model of agonism to distinguish efficacy from potency

  • For complex responses (e.g., biphasic):

    • Sum of multiple sigmoid functions

    • Empirical models that accommodate biphasic responses

    • Mechanistic models incorporating receptor states and downstream effectors

Parameter Estimation and Comparison:

ParameterDefinitionInterpretation for GPR119
EC50Concentration producing 50% of maximal effectMeasure of potency, typically in nM range for GPR119 agonists
EmaxMaximum effectReflects efficacy, important for comparing full vs. partial agonists
Hill slopeSteepness of the curveIndicates potential cooperativity or multiple binding sites
τ (tau)Transduction coefficientCombines affinity and efficacy in the operational model
BaselineResponse at zero concentrationImportant for detecting constitutive activity

Advanced Statistical Considerations:

  • Appropriate transformation:

    • Log-transformation of concentration data

    • Consider Box-Cox transformations for normalizing response data

    • Arcsin-sqrt transformation for proportional data

  • Model selection criteria:

    • Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC)

    • F-test for nested models

    • Visual inspection of residual plots

  • Robust statistical approaches:

    • Bootstrap resampling for confidence intervals

    • Permutation tests for comparing curve parameters

    • Mixed-effects models for repeated measures designs

Special Considerations for GPR119 Studies:

  • For glucose-dependent effects, analyze:

    • EC50 shifts across glucose concentrations

    • Changes in maximal response at different glucose levels

    • Area under the curve for integrated responses

  • For comparative agonist studies:

    • Relative activity scales normalized to a reference agonist

    • Bias calculations using operational models

    • Cluster analysis of agonists based on multiple parameters

When reporting results, include both best-fit parameters with confidence intervals and goodness-of-fit statistics. Graphical presentation should show individual data points overlaid with the fitted curve and confidence bands .

How can researchers effectively correlate structural modifications of GPR119 agonists with changes in signaling efficacy and selectivity?

Correlating structural modifications with functional outcomes requires systematic structure-activity relationship (SAR) analysis combined with structural biology insights:

Integrated Structure-Function Analysis Framework:

  • Systematic chemical modification approaches:

    • Core scaffold preservation with peripheral modifications

    • Bioisosteric replacements of key functional groups

    • Conformational constraint introduction

    • Stereochemical variations at chiral centers

  • Multi-parameter activity profiling:

    • Measure multiple signaling outputs (cAMP, Ca²⁺, β-arrestin recruitment)

    • Determine both potency (EC50) and efficacy (Emax) parameters

    • Assess selectivity against related receptors

    • Evaluate ADME properties in parallel

Data Analysis and Visualization Techniques:

Analysis MethodApplicationAdvantage
Free-Wilson analysisIdentify contribution of specific substituentsSimple, quantitative structure-activity insights
3D-QSAR modelingPredict activity of novel compoundsIncorporates spatial arrangements
Molecular dynamics simulationsUnderstand ligand-receptor interactionsProvides dynamic interaction picture
Principal component analysisIdentify patterns across multiple parametersReduces dimensionality of complex datasets
Cluster analysisGroup compounds with similar profilesIdentifies structure-activity patterns

Leveraging Structural Biology Data:

Recent structural studies of GPR119-Gs complexes bound to different agonists provide critical insights for correlation analysis :

  • Identify key interaction points:

    • The hydrophobic cavity between TM4 and TM5 is critical for endogenous ligand binding

    • Hydrophobic contacts between F157 and other residues are essential for activation

    • The salt bridge between ICL1 and Gβs is crucial for signaling

  • Create targeted mutation studies:

    • Design mutations based on structural data

    • Measure how each mutation affects binding and activation by different agonists

    • Correlate chemical modifications with altered interaction patterns

  • Develop structure-based pharmacophore models:

    • Generate models based on aligned bound agonists

    • Validate using activity data across structural series

    • Refine iteratively as new compounds are synthesized and tested

Case Study Application:

Comparing APD597 and APD668 illustrates this approach :

  • Despite structural similarity, APD597 shows better solubility

  • APD597 produces fewer hydroxyl metabolites with extended half-lives

  • Structural analysis revealed how specific substituents impact these properties

  • This information guided further optimization by targeting specific regions of the molecule

By systematically collecting and analyzing data across chemical series and comparing results with structural insights, researchers can develop predictive models that guide rational design of improved GPR119 agonists with optimized efficacy, selectivity, and pharmacokinetic properties.

What are the most promising approaches for developing biased GPR119 agonists that maximize beneficial metabolic effects while minimizing unwanted outcomes?

Developing biased GPR119 agonists represents a cutting-edge opportunity in metabolic disorder therapeutics, requiring sophisticated approaches:

Rational Design Strategies for Biased Agonism:

  • Structure-guided design:

    • Target specific receptor conformations based on cryo-EM structures of GPR119-Gs complexes

    • Design ligands that preferentially stabilize conformations favoring Gs coupling over β-arrestin recruitment

    • Focus on interactions with intracellular loop regions that dictate G protein coupling specificity

  • Pharmacophore-based approach:

    • Develop separate pharmacophore models for different signaling outcomes

    • Identify structural features correlating with beneficial versus unwanted effects

    • Design hybrid molecules incorporating features for desired pathway activation

  • Fragment-based discovery:

    • Screen fragment libraries against specific receptor conformations

    • Grow or link fragments that bind to regions implicated in pathway-specific signaling

    • Optimize fragments based on structural and functional data

Key Pathways to Target for Biased Agonism:

Signaling PathwayDesired EffectPotential Unwanted EffectsStructural Elements
Gs/cAMP/PKAInsulin secretion, GLP-1 releasePossible tachyphylaxis with chronic stimulationICL2, TM6 movement
β-arrestinReceptor internalization, potentially beneficial ERK signalingDesensitization, limiting chronic efficacyC-terminal phosphorylation sites
Alternative G proteinsTissue-specific effectsOff-target effects in non-target tissuesICL3 engagement

Screening and Validation Approaches:

  • Develop parallel high-throughput assays for multiple signaling pathways:

    • BRET/FRET-based assays for G protein activation

    • Enzyme complementation assays for β-arrestin recruitment

    • Pathway-specific reporter gene assays

  • Calculate bias factors using operational models of agonism:

    • Determine transduction coefficients for each pathway

    • Calculate bias factor relative to a reference agonist

    • Correlate bias with in vivo outcomes

  • Validate in physiologically relevant models:

    • Use tissue-specific knockout models to isolate pathway contributions

    • Employ ex vivo systems like perfused pancreas preparations

    • Develop transgenic models with pathway-selective GPR119 mutations

Translational Considerations:

  • Focus on specific therapeutic outcomes such as:

    • Balanced glucose-dependent insulin secretion without hypoglycemia risk

    • Enhanced incretin effect without GI side effects

    • Glucagon counterregulation during hypoglycemia without affecting normoglycemic glucagon levels

  • Consider tissue-selective agonism:

    • Pancreatic β-cell versus intestinal L-cell selective effects

    • Design agonists with differential distribution to target tissues

    • Explore prodrug approaches for tissue-targeted activation

The development of biased GPR119 agonists represents a sophisticated approach to fine-tune receptor signaling for optimal therapeutic benefit in metabolic disorders, potentially overcoming limitations of current non-selective approaches.

How might the differential expression of GPR119 across tissues influence experimental design and interpretation in preclinical studies?

The tissue-specific expression pattern of GPR119 creates both challenges and opportunities for research design and interpretation:

Tissue Expression Pattern Considerations:

  • Primary expression sites:

    • Pancreatic β-cells: Direct influence on insulin secretion

    • Intestinal enteroendocrine L-cells: Mediates GLP-1 and other incretin release

    • Emerging evidence for expression in liver and other tissues

  • Expression level variations:

    • Species differences in relative expression between tissues

    • Disease state-dependent alterations in receptor expression

    • Developmental changes in expression patterns

Experimental Design Implications:

TissueExperimental ApproachCritical ControlsAnalytical Considerations
PancreasIsolated islets, perfused pancreasVerify GPR119 expression levelsDistinguish direct effects from incretin-mediated effects
IntestineEnteroendocrine cell cultures, intestinal organoidsInclude GLP-1R antagonistsTime-resolved analysis for primary vs. secondary effects
LiverHepatocyte cultures, liver-specific knockout modelsMetabolic profilingDistinguish direct effects from hormone-mediated effects
Multiple tissuesTissue-specific conditional knockoutsRescue experimentsSystems biology approaches for integrated analysis

Strategies for Tissue-Specific Analysis:

  • Pharmacological approaches:

    • Use of vascular clamps in vivo to isolate tissue-specific effects

    • Portal vein versus peripheral blood sampling to distinguish intestinal versus pancreatic contributions

    • Tissue-selective drug delivery systems

  • Genetic approaches:

    • Tissue-specific promoter-driven Cre-lox systems for conditional knockouts

    • CRISPR-mediated tissue-specific mutagenesis

    • Humanized tissue-specific GPR119 expression models

  • Ex vivo approaches:

    • Sequential perfusion of intestine followed by pancreas to dissect direct versus incretin-mediated effects

    • Co-culture systems with multiple tissue types

    • Microfluidic organ-on-chip models with connected tissue compartments

Interpretation Frameworks:

  • Integrated physiological modeling:

    • Develop mathematical models incorporating tissue-specific GPR119 density

    • Account for temporal dynamics of direct and indirect effects

    • Consider feedback mechanisms between tissues

  • Biomarker selection for tissue-specific activation:

    • Tissue-selective downstream signaling markers

    • Spatiotemporal hormone release patterns

    • Metabolic flux analysis for tissue-specific metabolic effects

  • Translation to human physiology:

    • Compare tissue expression profiles between rat and human

    • Adjust interpretations based on known species differences

    • Consider using humanized models for critical verification studies

Researchers should explicitly acknowledge tissue expression differences when designing studies and interpreting results, particularly when extrapolating from single-tissue experiments to whole-organism effects or when translating findings between species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.