Recombinant Rat Glycerol-3-phosphate acyltransferase 3 (Agpat9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gpat3; Agpat9; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Lysophosphatidic acid acyltransferase theta; LPAAT-theta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Gpat3
Target Protein Sequence
MEGTDLVVKLLSTWLTLVGSLILLPSAFGLSLGISEIYMKILVKTLEWATLRIEKGAPKE SVLKSPASMGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE LVSWNLLTRTNVNFHYISPKLTIVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQ LPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILAT DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI FPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSW AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQ KTYSKMIVGNGSPSLALDSSTVDNHGSPEPAFRSESL
Uniprot No.

Target Background

Function

Recombinant Rat Glycerol-3-phosphate acyltransferase 3 (Agpat9) catalyzes the conversion of glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by incorporating an acyl moiety at the sn-1 position of the glycerol backbone. It also converts LPA to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position.

Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase 3 (Agpat9) and what reaction does it catalyze?

Glycerol-3-phosphate acyltransferase 3 (GPAT3), initially misidentified as AGPAT9, is an enzyme that catalyzes the first and rate-limiting step in the synthesis of glycerolipids . GPAT3/Agpat9 specifically catalyzes the acylation of glycerol-3-phosphate using long-chain acyl-CoA as the acyl donor to produce lysophosphatidic acid (LPA) . This reaction represents the initial step in the Kennedy pathway for glycerolipid synthesis, which ultimately leads to the formation of triacylglycerols (TAGs) and phospholipids that are essential for cell membranes and energy storage.

The enzyme belongs to the acyltransferase family characterized by several highly conserved motifs, including the pfam 01553 acyltransferase domain . The reaction catalyzed can be represented as:

Glycerol-3-phosphate + Acyl-CoA → Lysophosphatidic acid + CoA

How does GPAT3/Agpat9 contribute to triacylglycerol synthesis?

GPAT3/Agpat9 contributes to triacylglycerol synthesis by catalyzing the initial and rate-limiting step in the glycerolipid synthesis pathway . After GPAT3/Agpat9 produces lysophosphatidic acid, subsequent enzymes in the pathway, including acylglycerolphosphate acyltransferases (AGPATs), phosphatidate phosphatases (lipins), and diacylglycerol acyltransferases (DGATs), complete the synthesis of triacylglycerol .

Evidence from both gain-of-function and loss-of-function studies in mice and cell cultures strongly suggests that GPAT3/Agpat9, like other GPAT isoforms, plays a significant role in triacylglycerol synthesis . For instance, in differentiated 3T3-L1 adipocytes, siRNA-mediated knockdown of GPAT3 (reducing mRNA by 60%) resulted in approximately 55% reduction in total GPAT activity, demonstrating its substantial contribution to triacylglycerol synthesis in adipocytes .

How do GPAT and AGPAT enzyme families differ functionally?

GPAT and AGPAT enzymes catalyze sequential steps in the glycerolipid synthesis pathway but target different substrates:

  • GPAT enzymes (including GPAT1, GPAT2, GPAT3/Agpat9, and GPAT4) catalyze the acylation of glycerol-3-phosphate to form lysophosphatidic acid .

  • AGPAT enzymes (including AGPAT1, AGPAT2, and others) catalyze the acylation of lysophosphatidic acid to form phosphatidic acid .

Though both enzyme families belong to the acyltransferase superfamily and share conserved motifs, they have distinct substrate specificities and roles in the glycerolipid synthesis pathway . This functional differentiation is reflected in their sequence homology and cellular distribution patterns. The confusion in nomenclature (with GPAT3 being initially mislabeled as AGPAT8 or AGPAT9) arose from sequence similarities between these related enzyme families .

How many GPAT and AGPAT isoforms have been identified and what are their subcellular localizations?

Four distinct GPAT isoforms (GPAT1-4) have been identified, each encoded by a separate gene . These isoforms differ in their subcellular localization and tissue distribution:

  • GPAT1: Located in the outer mitochondrial membrane

  • GPAT2: Also located in the outer mitochondrial membrane

  • GPAT3/Agpat9: Located exclusively in the endoplasmic reticulum

  • GPAT4: Located in the endoplasmic reticulum

Similarly, multiple AGPAT isoforms have been identified (AGPAT1-5 and others), primarily localized to the endoplasmic reticulum . The subcellular localization of these enzymes is functionally significant because it influences their access to substrates and their roles in specific metabolic pathways.

For example, mitochondrial GPAT1 may preferentially channel acyl-CoAs toward triacylglycerol synthesis rather than fatty acid oxidation, while the ER-localized GPAT3 and GPAT4 may play more significant roles in the synthesis of both phospholipids and triacylglycerols .

What are the conserved motifs that characterize GPAT3/Agpat9?

GPAT3/Agpat9 contains four highly conserved motifs that are characteristic of the pfam 01553 acyltransferase family . These motifs are critical for substrate binding and catalytic activity:

  • Motif I: Contains the sequence "NHQ/NHR" and is involved in glycerol-3-phosphate binding

  • Motif II: Contains basic residues implicated in acyl-CoA binding

  • Motif III: Features the invariant proline and glycine in "FPEGT" important for catalysis

  • Motif IV: Involved in binding both substrates

The presence of these conserved motifs in the GPAT3/Agpat9 protein sequence was crucial for its eventual correct identification as a GPAT enzyme rather than an AGPAT enzyme . The alignment of these conserved motifs across species helped identify the full-length human AGPAT9 (GPAT3) sequence including additional amino-terminal sequences that were initially missed in database entries .

How was GPAT3/Agpat9 initially misidentified and later correctly classified?

GPAT3 was initially mislabeled in GenBank as AGPAT8 (LPAAT-theta) based on sequence homology to AGPAT1 and AGPAT2 enzymes . This misidentification was corrected by Cao and colleagues who identified it as GPAT3 based on both sequence similarities to acyltransferases and functional studies .

The researchers cross-referenced genes that increased during adipocyte differentiation, noting that microsomal GPAT activity had been reported to increase 70-fold during 3T3-L1 differentiation . Mouse and human GPAT3 encode 438- and 434-amino acid proteins, respectively, both with an approximate molecular mass of 50 kDa and exclusively expressed in the endoplasmic reticulum .

The correct identification was confirmed through enzymatic assays demonstrating that the protein catalyzed the GPAT reaction (acylation of glycerol-3-phosphate) rather than the AGPAT reaction (acylation of lysophosphatidic acid) . This reclassification highlights the importance of functional characterization beyond sequence homology in enzyme classification.

What are the optimal methods for cloning rat Agpat9?

The optimal methods for cloning rat Agpat9 involve several key steps, similar to those described for human AGPAT9 in the literature :

  • Initial amplification: Design primers within the coding region to amplify mRNA from tissues known to express the gene (such as adipose tissue for GPAT3/Agpat9) .

  • Full ORF amplification: After confirming the initial sequence, design additional primers in the 5' and 3' untranslated regions to amplify the entire open reading frame (ORF) in overlapping fragments .

  • Fragment combination: Purify and sequence the overlapping PCR fragments, then combine them by reamplification using only the 5' and 3' flanking primers .

  • Cloning into expression vector: Clone the full-length ORF into an appropriate cloning vector (such as pDrive) for further sequencing and subsequent subcloning steps .

  • Expression vector construction: For expression studies, the ORF should be subcloned into a mammalian expression vector (such as pcDNA3.1) with appropriate restriction sites incorporated into the primers for directional cloning .

When working with rat Agpat9, researchers should be aware of potential species-specific differences in sequence and conduct thorough sequence verification at each step.

How can expression vectors for GPAT3/Agpat9 be designed for different experimental purposes?

Expression vectors for GPAT3/Agpat9 can be designed with various modifications to suit different experimental purposes:

  • Basic expression vector: For enzymatic activity studies, the full-length ORF can be cloned into a mammalian expression vector with a strong promoter (e.g., CMV) to ensure high-level expression .

  • Epitope-tagged constructs: For protein detection and localization studies, constructs can be generated with epitope tags such as V5. When adding tags, care should be taken to remove the first ATG of the protein to prevent spurious protein translation .

  • Fluorescent protein fusions: For subcellular localization studies, fusion constructs with fluorescent proteins like EGFP can be created. This requires careful design to ensure the tag doesn't disrupt protein folding or function .

  • Long and short form constructs: Based on sequence alignment with homologous proteins from other species, it may be necessary to create both long and short form constructs to ensure the proper translation of the full protein .

Each construct should be verified by sequencing, particularly at the junction points between the insert and vector or between the protein and tag sequences .

What are the considerations for generating stably expressing cell lines of GPAT3/Agpat9?

When generating stably expressing cell lines of GPAT3/Agpat9, several key considerations should be addressed:

  • Cell line selection: Choose appropriate cell lines (such as CHO cells) that have low endogenous expression of the target enzyme to maximize signal-to-noise ratio .

  • Selection marker: Include an appropriate selection marker (such as G418 resistance) in the expression vector to allow for selection of stably transfected cells .

  • Selection concentration optimization: Determine the optimal concentration of the selection agent (e.g., 500 μg/ml G418) for the specific cell line being used .

  • Pool vs. clone approach: Decide whether to use pools of resistant cells or isolated clones. Pools can provide a more representative average expression but may show more variability, while clones can provide more consistent expression but may suffer from clonal artifacts .

  • Expression verification: Confirm expression of the recombinant protein using RT-PCR, Western blotting, or enzymatic activity assays before proceeding with experiments .

  • Control cells: Generate parallel control cell lines transfected with empty vector to serve as proper experimental controls .

What are the established methods for measuring GPAT3/Agpat9 enzymatic activity?

The established methods for measuring GPAT3/Agpat9 enzymatic activity involve several key steps:

  • Sample preparation: Cells expressing GPAT3/Agpat9 are harvested, typically by scraping in an appropriate buffer (e.g., 20 mM Tris-HCl, pH 7.5, and 5 mM NaCl) containing protease inhibitors .

  • Cell disruption: The harvested cells undergo freeze-thaw cycles and/or sonication (e.g., three times with 7-second bursts, followed by cooling on ice) to release the enzyme .

  • Activity assay: The standard GPAT assay typically measures the incorporation of radiolabeled acyl-CoA (e.g., [14C]palmitoyl-CoA) into lysophosphatidic acid in the presence of glycerol-3-phosphate .

  • Discrimination from other acyltransferases: To differentiate GPAT activity from other acyltransferases, assays can be conducted with and without N-ethylmaleimide (NEM), as ER-localized GPAT isoforms like GPAT3 are typically NEM-sensitive .

  • Substrate specificity analysis: Testing the enzyme's activity with different acyl-CoA species (saturated vs. unsaturated) can provide insights into substrate preferences .

  • Data normalization: Activity should be normalized to protein concentration and expressed as nmol of product formed per minute per mg protein .

How can subcellular localization of GPAT3/Agpat9 be determined?

Subcellular localization of GPAT3/Agpat9 can be determined using several complementary approaches:

  • Fluorescent protein fusion: Creating fusion proteins with fluorescent tags like EGFP allows direct visualization of the protein's localization in living cells . For GPAT3/Agpat9, this has confirmed endoplasmic reticulum localization .

  • Co-localization studies: Co-expressing GPAT3/Agpat9 with known subcellular markers (such as AGPAT1-REP for ER localization) allows precise determination of its compartmental distribution .

  • Immunofluorescence microscopy: Using antibodies against the native protein or epitope tags (like V5) incorporated into the recombinant protein for immunostaining .

  • Cell fractionation: Biochemical separation of cellular compartments followed by Western blotting or enzymatic activity measurements can confirm the protein's presence in specific fractions .

  • Advanced imaging techniques: Techniques such as deconvolution microscopy can provide high-resolution images of the protein's localization patterns .

For GPAT3/Agpat9, these approaches have consistently demonstrated its localization to the endoplasmic reticulum, distinguishing it from mitochondrial GPAT isoforms (GPAT1 and GPAT2) .

What approaches can be used to study the tissue distribution of GPAT3/Agpat9?

Several approaches can be used to study the tissue distribution of GPAT3/Agpat9:

  • Quantitative real-time PCR (qRT-PCR): This is a sensitive method for measuring mRNA expression levels across different tissues. Using specific primers and probes (e.g., 5'-TCGCTGACTTCCACAGGTTTG-3' and 5'-GGTGAGGTCTCTGCACAGCTTT-3' with a FAM-labeled probe) allows quantification of GPAT3/Agpat9 expression relative to housekeeping genes like G3PDH .

  • Northern blotting: Though less sensitive than qRT-PCR, this technique provides information about transcript size in addition to expression levels .

  • Western blotting: Using specific antibodies against GPAT3/Agpat9 or epitope tags in recombinant constructs can determine protein expression levels across tissues .

  • Enzymatic activity assays: Measuring NEM-sensitive GPAT activity in tissue homogenates can provide functional evidence of GPAT3/Agpat9 presence, though this may not distinguish between different ER-localized GPAT isoforms .

  • In situ hybridization: This technique can localize mRNA expression within specific cell types in complex tissues .

Studies using these approaches have shown that GPAT3/Agpat9 expression is particularly high in adipose tissue and increases dramatically during adipocyte differentiation .

How is GPAT3/Agpat9 expression regulated during adipocyte differentiation?

GPAT3/Agpat9 expression is dramatically upregulated during adipocyte differentiation, making it an important marker of adipogenesis:

  • In 3T3-L1 adipocytes, GPAT3/Agpat9 mRNA expression increases approximately 60-fold after differentiation . This significant increase suggests that GPAT3/Agpat9 plays a crucial role in the lipid metabolism of mature adipocytes.

  • The increased expression correlates with a substantial increase in total GPAT activity, which has been reported to increase up to 70-fold during 3T3-L1 differentiation .

  • The regulation of GPAT3/Agpat9 during adipogenesis likely involves transcription factors that control adipocyte differentiation, such as PPARγ and C/EBPα, though the specific transcriptional mechanisms have not been fully elucidated in the provided search results.

  • The dramatic increase in GPAT3/Agpat9 expression during adipogenesis highlights its importance in triacylglycerol synthesis and storage in adipose tissue, which are essential functions of mature adipocytes .

What is known about the hormonal regulation of GPAT3/Agpat9?

While the search results do not provide specific information about the hormonal regulation of GPAT3/Agpat9, they do mention that GPAT1 activity is affected by insulin and AMP-activated protein kinase . Given the related functions of GPAT isoforms, it is reasonable to hypothesize that GPAT3/Agpat9 may also be subject to hormonal regulation, particularly by factors that influence lipid metabolism.

Potential hormonal regulators might include:

How does GPAT3/Agpat9 contribute to metabolic homeostasis?

GPAT3/Agpat9 contributes to metabolic homeostasis through its role in triacylglycerol synthesis and storage, particularly in adipose tissue:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.