Recombinant Rat Glycosyltransferase 6 domain-containing protein 1 (Glt6d1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant Rat Glt6d1 is produced through cell-free protein synthesis (CFPS) or mammalian expression systems. Key features include:

ParameterDetailsSource
Expression RegionFull-length protein (AA 1–311)
Species OriginRattus norvegicus (Rat)
Tag InformationStrep Tag or His Tag (varies by production method)
Purification MethodOne-step Strep-tag purification or affinity chromatography
Storage BufferTris-based buffer with 50% glycerol
StabilityStored at -20°C; avoid repeated freeze-thaw cycles

The protein’s sequence includes a glycosyltransferase domain, critical for transferring hexosyl groups . Sequence homology to mouse and rat orthologs is ~61% .

Domain Architecture

Glt6d1 contains a glycosyltransferase domain (GT6 family), which facilitates enzymatic activity such as hexose transfer. Its structure includes:

  • N-terminal region: Predicted signal peptides or transmembrane domains (in some isoforms) .

  • Catalytic core: Residues critical for substrate binding and enzymatic activity .

Key Interactions

Glt6d1 interacts with proteins involved in glycosylation pathways, including:

Interacting ProteinFunctionReference
UGT2B5UDP-glucuronosyltransferase activity
GBGT1Glycosphingolipid biosynthesis

Enzymatic Studies

Recombinant Glt6d1 is used to study glycosyltransferase activity in vitro. Its role in transferring hexosyl groups is critical for carbohydrate biosynthesis and cell signaling .

Disease Models

  • Periodontitis: Polymorphisms in GLT6D1 (e.g., rs1537415) have been linked to aggressive periodontitis, though studies in Brazilian cohorts showed no association .

  • Toxicity Studies: Exposure to arsenic trioxide or bisphenol A alters GLT6D1 expression in rats, suggesting a role in stress responses .

Chemical Interactions

ChemicalEffect on Glt6d1MechanismReference
Arsenic Trioxide↑ ExpressionInduces oxidative stress
Bisphenol A↓ Expression (contradictory reports)Epigenetic modification

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific requirement for the format, please specify it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Glt6d1; Glycosyltransferase 6 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Glt6d1
Target Protein Sequence
MKAKGRILLLTSCLFLLLLLLAKIHLRNHQEEELPLSDWFDPRRRLDVITTTDWLAPVIWEGTFDRKVLEKYYHKQNITMGLTVFAVSSFNGQYLDPFLQSASKFFMPGYRVIFYIMVDKSLKLPEMGHNPLQSFQVLVVSQERQWSDFDLMRMTVLSKHIREHIRFEVDFLFVMSVNMVFQNVFGVETLSTSVAQLHAWWYFRKTTHLPYERRPTSAAYIPFGLGDFYYAGAIIGGVPFQVLDFTHQYLKSVILDIENGVNSTYEKYLNKYFFLNKPTKLLSPEYSWDQTFNIPQQVHYVKVAHYPTDDL
Uniprot No.

Target Background

Database Links
Protein Families
Glycosyltransferase 6 family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is the basic structure and function of Rat GLT6D1?

Rat Glycosyltransferase 6 Domain-Containing Protein 1 (GLT6D1) is a 311-amino acid protein belonging to the glycosyltransferase family. The protein contains a predicted glycosyltransferase domain, suggesting involvement in glycosylation processes. The recombinant form is typically expressed with a His-tag for purification purposes. The full amino acid sequence includes: "MKAKGRILLL TSCLFLLLLL LAKIHLRNHQ EEELPLSDWF DPRRRLDVIT TTDWLAPVIW EGTFDRKVLE KYYHKQNITM GLTVFAVSSF NGQYLDPFLQ SASKFFMPGY RVIFYIMVDK SLKLPEMGHN PLQSFQVLVV SQERQWSDFD LMRMTVLSKH IREHIRFEVD FLFVMSVNMV FQNVFGVETL STSVAQLHAW WYFRKTTHLP YERRPTSAAY IPFGLGDFYY AGAIIGGVPF QVLDFTHQYL KSVILDIENG VNSTYEKYLN KYFFLNKPTK LLSPEYSWDQ TFNIPQQVHY VKVAHYPTDD L" . The protein likely functions in the glycosylation pathway, though its specific substrates and products require further characterization.

How conserved is GLT6D1 across species?

GLT6D1 shows conservation across mammalian species, with recombinant forms available from various species including rat, mouse, cow, and cynomolgus macaque . The conservation suggests important biological functions. Research indicates that the rat GLT6D1 protein shares significant homology with human GLT6D1, making it a valuable model for studying human glycosylation processes. The available recombinant proteins from different species (AA 1-308 or AA 1-311) with similar expression systems indicate functional domain conservation across mammals.

What expression systems are most effective for recombinant GLT6D1 production?

Several expression systems have been utilized for GLT6D1 production with varying advantages:

Expression SystemAdvantagesPurityApplicationsTag Options
Yeast expressionMost economical and efficient eukaryotic system; appropriate post-translational modifications>90%ELISAHis tag
Mammalian cells (HEK-293)Produces protein closest to natural conformation>90%ELISA, Western Blot, analytical SECHis tag, Strep tag
Cell-free protein synthesisRapid production, avoids cellular toxicity70-80%ELISA, SDS, Western BlotStrep tag
E. coliHigh yield, cost-effectiveVariableLimited by lack of glycosylationMultiple options

What is the significance of the rs1537415 polymorphism in GLT6D1?

The single nucleotide polymorphism (SNP) rs1537415 in GLT6D1 has been significantly associated with aggressive periodontitis across multiple populations. Research in a Sudanese population demonstrated this association remained significant after Bonferroni correction for multiple testing (p=0.013) . This finding independently replicates the identification of rs1537415 as a candidate genetic variant in one of the few genome-wide association studies (GWAS) of aggressive periodontitis reported to date (Schaefer et al. 2010) . The consistency of this association across different ethnic populations strengthens the evidence for GLT6D1's role in periodontal disease pathogenesis.

How should researchers approach genotyping GLT6D1 polymorphisms?

For reliable genotyping of GLT6D1 polymorphisms such as rs1537415, researchers should employ real-time quantitative PCR using predesigned TaqMan SNP assays. The methodological approach involves:

  • DNA extraction from biological samples (e.g., blood)

  • Spectrophotometric assessment of DNA concentration and purity (260/280 nm OD ratio)

  • Dilution to standardized concentration (typically 10 ng/μL)

  • PCR amplification in a reaction volume containing:

    • 1 μL genomic DNA (10 ng/μL)

    • 6.25 μL Master Mix 2x

    • 0.63 μL 20x TaqMan Assay Mix

    • 4.63 μL RNA/DNase-free water

Results should be verified through Hardy-Weinberg equilibrium testing using software like Haploview 4.2, with a significance cutoff of p<0.05 . This approach ensures reliable genotyping results for association studies.

What statistical approaches are recommended for analyzing GLT6D1 genetic association data?

Statistical analysis of GLT6D1 genetic association data requires a multi-faceted approach to ensure robust findings:

  • Hardy-Weinberg equilibrium testing to ensure genetic data quality

  • Pearson's Chi-Square test to examine associations between allele frequencies and disease phenotypes

  • Calculation of odds ratios (OR) and 95% confidence intervals to report association strength

  • Application of Bonferroni correction for multiple testing to minimize false positives

  • Consideration of population stratification using programs like STRUCTURE

For strengthening findings, researchers should consider secondary analyses incorporating data from reference populations (e.g., HapMap) to supplement control groups . Additionally, trend tests can provide insights into dose-dependent genetic effects. When inconsistencies arise between studies, researchers should evaluate potential contributing factors including statistical power, linkage disequilibrium, and population differences .

How should researchers design experiments to investigate GLT6D1 functional activity?

Investigating GLT6D1 functional activity requires careful experimental design considering its predicted glycosyltransferase activity. A comprehensive approach should include:

  • Substrate specificity determination:

    • Testing various potential glycosyl donors and acceptors

    • Using recombinant GLT6D1 with confirmed purity (>90%)

    • Including appropriate positive and negative controls

  • Enzymatic activity assays:

    • Monitoring glycosyl transfer via radioactive, fluorescent, or colorimetric methods

    • Determining optimal buffer conditions (pH, temperature, ion requirements)

    • Measuring enzyme kinetics (Km, Vmax) for identified substrates

  • Cellular studies:

    • Overexpression and knockdown studies in relevant cell types

    • Assessment of glycosylation profile changes

    • Identification of cellular substrates via mass spectrometry

The use of high-purity recombinant protein (>90% as determined by techniques like SDS-PAGE and Western Blot) is essential for reliable functional characterization.

What controls are necessary when studying GLT6D1 in disease models?

When investigating GLT6D1 in disease models, particularly periodontitis, researchers should implement these essential controls:

  • Genotype controls:

    • Include matched controls for age, sex, and ethnicity

    • Verify Hardy-Weinberg equilibrium in study populations

    • Consider potential population stratification effects

  • Experimental controls:

    • Include wild-type vs. variant GLT6D1 in functional studies

    • Use enzymatically inactive GLT6D1 mutants as negative controls

    • Include positive controls with known glycosyltransferase activity

  • Clinical controls:

    • Clearly define case and control groups using standardized disease criteria

    • Record confounding variables (smoking status, age, other medical conditions)

    • Consider disease severity staging (e.g., periodontitis stages III and IV, grades B and C)

The definition of clear inclusion/exclusion criteria is critical, as demonstrated in studies of aggressive periodontitis where factors like smoking status can significantly impact results .

What are appropriate applications for recombinant rat GLT6D1 protein?

Recombinant rat GLT6D1 protein with His-tag (AA 1-311) is suitable for various research applications including:

  • Enzyme activity characterization:

    • Substrate specificity determination

    • Kinetic parameter measurements

    • Inhibitor screening

  • Immunological applications:

    • ELISA assays for detecting GLT6D1 or its interaction partners

    • Generation and validation of antibodies

    • Immunoprecipitation studies

  • Structural biology:

    • Crystallization trials for structure determination

    • Protein-protein interaction studies

    • Epitope mapping

  • Comparative studies:

    • Cross-species functional conservation analysis

    • Domain function analysis using truncated constructs

The high purity (>90%) of commercially available recombinant GLT6D1 makes it appropriate for these applications, though researchers should select the expression system (yeast, mammalian, or cell-free) based on their specific experimental requirements.

How should researchers interpret conflicting genetic association results for GLT6D1?

When confronted with inconsistent genetic association results for GLT6D1 across different studies, researchers should systematically evaluate multiple potential causes:

  • Statistical power considerations:

    • Assess sample sizes in conflicting studies

    • Evaluate true effect size estimates and variance

    • Consider allele frequencies in different populations

  • Technical and methodological differences:

    • Compare genotyping methods and quality control procedures

    • Assess imputation quality if imputed variants were used

    • Evaluate correction for multiple testing approaches

  • Population-specific factors:

    • Consider differences in linkage disequilibrium patterns across populations

    • Evaluate potential gene-environment interactions

    • Assess population stratification effects

For example, in GLT6D1 studies, the rs1537415 association with periodontitis has been consistently replicated, while associations for other variants (like rs16944 in IL1beta) showed inconsistent results after incorporation of reference population data . Researchers should use approaches like trans-ethnic mapping to distinguish causal variants from indirect associations, particularly when studies span different ethnic populations .

What are common challenges in expressing and purifying recombinant GLT6D1?

Researchers working with recombinant GLT6D1 may encounter several challenges:

ChallengePotential CausesSolutions
Low expression yieldProtein toxicity, codon usage bias, improper foldingOptimize codon usage, use specialized host strains, adjust induction conditions
Protein insolubilityImproper folding, hydrophobic domains, aggregationTest different solubilization buffers, use fusion tags, express in eukaryotic systems
Impaired activityIncorrect post-translational modifications, improper foldingUse mammalian expression systems for critical studies requiring native activity
Purification difficultiesHis-tag inaccessibility, non-specific bindingTry different purification strategies, adjust imidazole concentrations, use dual tagging

The yeast expression system offers economic advantages but may not provide optimal post-translational modifications. For studies requiring protein closest to its natural form, mammalian cell expression is recommended despite higher cost . For challenging proteins, cell-free protein synthesis may provide an alternative approach with 70-80% purity .

How can researchers address quality control issues with GLT6D1 genetic studies?

Quality control is critical for reliable GLT6D1 genetic studies. Researchers should implement:

  • Genotyping quality control:

    • Hardy-Weinberg equilibrium testing (p<0.05 threshold)

    • Assessment of genotyping call rates (>95% recommended)

    • Inclusion of duplicate samples for concordance checks

    • Careful exclusion of problematic SNPs and samples

  • Statistical rigor:

    • Appropriate correction for multiple testing

    • Evaluation of statistical power before study initiation

    • Consideration of additive, dominant, and recessive genetic models

    • Incorporation of reference population data where appropriate

  • Population considerations:

    • Assessment of population stratification using methods like STRUCTURE

    • Transparent reporting of participant demographics

    • Stratified analyses when appropriate

For example, in a GLT6D1 study with Sudanese participants, researchers verified Hardy-Weinberg equilibrium and used STRUCTURE to analyze population stratification, dividing the study population into three defined clusters showing within and between cluster homogeneity .

What functional genomics approaches can advance understanding of GLT6D1?

Advanced functional genomics approaches can elucidate GLT6D1's biological roles:

  • CRISPR/Cas9 genome editing:

    • Generate GLT6D1 knockout cell lines

    • Create specific point mutations mirroring disease-associated variants

    • Develop knock-in reporter systems for expression analysis

  • Single-cell RNA sequencing:

    • Characterize GLT6D1 expression patterns in tissues of interest

    • Identify cell types with highest expression

    • Analyze co-expression networks to identify functional relationships

  • Chromatin immunoprecipitation sequencing (ChIP-seq):

    • Identify transcription factors regulating GLT6D1 expression

    • Map epigenetic modifications around the GLT6D1 locus

    • Compare regulatory patterns between healthy and disease states

  • Proteomics approaches:

    • Identify GLT6D1 interaction partners

    • Characterize substrate proteins for glycosylation

    • Analyze glycosylation patterns in disease models

These approaches can help bridge the gap between genetic associations (like rs1537415) and functional consequences in periodontitis pathogenesis.

How can researchers establish causality between GLT6D1 variants and disease mechanisms?

Establishing causality between GLT6D1 variants and disease mechanisms requires a multi-disciplinary approach:

  • Fine-mapping studies:

    • Perform dense genotyping around significant SNPs

    • Use trans-ethnic mapping to leverage different linkage disequilibrium patterns

    • Apply statistical methods to identify likely causal variants

  • Functional validation:

    • Create cellular models expressing wild-type vs. variant GLT6D1

    • Assess enzymatic activity differences

    • Evaluate effects on relevant cellular phenotypes

  • Animal models:

    • Develop knock-in models with disease-associated variants

    • Analyze tissue-specific effects of mutations

    • Test therapeutic interventions targeting the pathway

  • Human studies:

    • Correlate genotypes with glycosylation profiles in patient samples

    • Perform longitudinal studies to assess disease progression

    • Evaluate gene-environment interactions

The consistent association of rs1537415 with aggressive periodontitis across different populations provides a strong foundation for such causal investigations .

What are the most promising future research directions for GLT6D1?

The most promising future research directions for GLT6D1 include:

  • Detailed structural characterization of the protein to understand how genetic variants affect function

  • Comprehensive substrate identification to clarify its role in glycosylation pathways

  • Development of functional assays that can detect variant-specific differences in enzymatic activity

  • Integration of multi-omics data to understand GLT6D1's role in disease networks

  • Exploration of therapeutic approaches targeting GLT6D1 or its downstream effectors for periodontitis treatment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.