Recombinant Rat GPI transamidase component PIG-S (Pigs)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, for specific format requirements, please indicate your preference in the order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery time.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Pigs; GPI transamidase component PIG-S; Phosphatidylinositol-glycan biosynthesis class S protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-555
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
ATAGAAATDLEVVRGKRAALFFAAVAILLGLPLWWKTTETYRAPLPYSEISGLNALQLRL MVPVTVVFTRDSVPLDDQEKLPFTVVHEREIPLKYKMKIKCRFQKAYRRALEHEEEALSL GSVHEAEALLAEPEKQAEGSLTVYVISEHSSLLPQDMMSYIGPERTAIVRGMIHREAFNI IGRRIIHVAQAMSLTEDVLAAALADHLPEDKWSSDKRRPLKSSLGYEITFSLLNPDPKSH DVHWDIEEGVQRYVQPFLNRLSAAGNFSVDSQILYYAMLGVNPRFDPASSSYSLAMHSLP HVINPVESRLGSSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIMV YNVDPKIYNASELPVRVEVDMAQVMEVFLAQLRLLFGIAQPQVPPKCLLSGPKSEGLMTW ELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYRAVAAVQKAAEALAL GHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKIF LETHKSWKKPEKID
Uniprot No.

Target Background

Function
Component of the GPI transamidase complex. Essential for the transfer of GPI to proteins, particularly for the formation of carbonyl intermediates.
Database Links
Protein Families
PIGS family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of PIG-S in the GPI transamidase complex?

PIG-S functions as an essential component of the glycosylphosphatidylinositol (GPI) transamidase complex, which is responsible for attaching GPI anchors to proteins in the endoplasmic reticulum. This complex mediates a critical post-translational modification by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. Research has demonstrated that PIG-S plays a particularly important role in the formation of carbonyl intermediates during the transamidation reaction. Studies using gene disruption techniques in mouse F9 cells have confirmed that PIG-S knockout cells are defective in transferring GPI to proteins, specifically in forming these carbonyl intermediates .

The GPI transamidase complex consists of five identified subunits: GPI8, GAA1, PIG-S, PIG-T, and PIG-U. Each component has specific functions, with PIG-S working in coordination with the other subunits to enable proper GPI anchoring. In yeast, the ortholog of PIG-S is Gpi17p (YDR434W), suggesting evolutionary conservation of this important cellular mechanism .

How does the absence of PIG-S affect cellular function in experimental models?

When PIG-S is disrupted in experimental models, cells exhibit significant defects in GPI anchor synthesis and attachment to proteins. Homologous recombination techniques used to create PIG-S knockout cells have revealed that these cells are unable to properly express GPI-anchored proteins on their cell surface. This deficiency results from a specific failure in the transamidation reaction, particularly in the formation of the carbonyl intermediates essential for GPI transfer .

The absence of PIG-S does not prevent the other components (GAA1, GPI8, PIG-T, and PIG-U) from forming a complex, but this complex lacks GPI transamidase activity. Without PIG-S, the complex cannot cleave the GPI attachment signal peptide, which is a critical step in the anchoring process. This indicates that PIG-S plays a specific functional role in the enzymatic activity rather than merely serving as a structural component of the complex .

What methods are available for detecting GPI transamidase complex activity in PIG-S research?

Several methodological approaches exist for assessing GPI transamidase activity in PIG-S research:

  • Fluorescent GPI-sensor assays: A novel approach involves using GPI-anchored fluorescent proteins (GPI-GFP and GPI-mCherry) as sensors. This method eliminates the need for antibody staining and allows for direct visualization of GPI anchoring through fluorescence microscopy. Mutations or deficiencies in GPI anchor synthesis components like PIG-S result in an absence of fluorescent signal .

  • In vitro GPI transamidase activity assays: These assays typically involve measuring the ability of cell extracts to transfer synthetic GPI anchors to substrate proteins. Loss of activity in cells with PIG-S mutations confirms its essential role in the transamidase function .

  • Surface expression analysis: Flow cytometry using fluorescently labeled antibodies against GPI-anchored proteins can quantitatively assess the impact of PIG-S mutations on surface expression of these proteins .

  • Proaerolysin (PA) resistance testing: Since PA specifically binds to GPI-anchored proteins, cells deficient in GPI anchor synthesis (due to PIG-S mutations) exhibit resistance to PA toxicity, providing a functional readout of GPI anchoring defects .

What are the optimal experimental strategies for studying PIG-S interactions with other GPI transamidase components?

To effectively study PIG-S interactions with other GPI transamidase components, researchers should consider these advanced methodological approaches:

  • Co-immunoprecipitation with denaturing conditions: Standard co-IP techniques may not be sufficient for highly hydrophobic proteins like PIG-S. Research has shown that adding 6 M urea to enhance denaturing conditions can reveal distinct bands for PIG-S that might otherwise appear as faint smears. This approach was successfully used to demonstrate that PIG-S is indeed part of the five-component GPI transamidase complex .

  • Epitope tagging strategies: Different epitope tags (HA, FLAG, etc.) can be used to differentially label complex components. For example, researchers have transfected cDNAs of differentially tagged PIG-S, PIG-T, GAA1, and GPI8 to study complex formation in the absence of specific components .

  • Cross-linking studies: Due to the transient nature of some protein-protein interactions within the complex, chemical cross-linking followed by mass spectrometry analysis can identify contact points between PIG-S and other components.

  • Structural biology approaches: Cryo-electron microscopy or X-ray crystallography of the complex can provide insights into the specific arrangement and interactions of PIG-S within the GPI transamidase complex.

TechniqueApplicationAdvantagesLimitations
Co-IP with denaturantsDetecting hydrophobic componentsReveals hidden proteinsMay disrupt some interactions
Epitope taggingTracking multiple componentsAllows differential detectionTags may affect function
Cross-linkingCapturing transient interactionsPreserves in vivo associationsMay introduce artifacts
Structural biologyDetailed molecular arrangementProvides atomic-level insightsTechnically challenging

How can gene disruption techniques be optimized for PIG-S functional studies in various cell models?

Gene disruption techniques for PIG-S functional studies can be optimized through:

  • Homologous recombination strategies: As demonstrated in the F9 embryonal carcinoma cell model, replacing the region containing the initiation codon with a drug resistance gene has proven effective. Southern blot analysis can confirm successful disruptions by showing the disappearance of wild-type alleles and appearance of mutant alleles of predicted sizes .

  • CRISPR-Cas9 genome editing: For more precise and efficient targeting, CRISPR-Cas9 can be used to introduce specific mutations or deletions in the PIG-S gene. Multiple guide RNAs targeting different regions of the gene can enhance knockout efficiency.

  • Conditional knockout systems: For studying essential genes like PIG-S in models where complete knockout might be lethal, inducible systems (Tet-On/Off, Cre-loxP) allow for temporal control of gene disruption.

  • Complementation assays: To confirm that observed phenotypes are specifically due to PIG-S disruption, rescue experiments using wild-type or mutant versions of PIG-S can be performed. For instance, studies have shown that the yeast ortholog Gpi17p can partially restore GPI-anchored proteins on the surface of mammalian cells lacking PIG-S, suggesting functional conservation .

  • Verification procedures: Multiple verification steps should be implemented, including:

    • PCR genotyping

    • Western blotting for protein expression

    • Functional assays for GPI anchoring (e.g., fluorescent GPI-sensors)

    • Phenotypic characterization of surface GPI-anchored proteins

What are the most reliable markers for assessing PIG-S-dependent GPI anchoring efficiency?

When evaluating PIG-S-dependent GPI anchoring efficiency, researchers should consider these reliable markers and methodologies:

  • Fluorescent GPI-sensor systems: The development of GPI-anchored fluorescent proteins (GPI-GFP and GPI-mCherry) provides a direct visual marker of GPI anchoring efficiency. This novel approach eliminates the variability and specificity issues associated with antibody-based detection methods .

  • Proaerolysin (PA) resistance: PA specifically binds to GPI-anchored proteins, making resistance to PA toxicity a reliable functional readout of GPI anchoring defects. Cells with compromised PIG-S function exhibit increased PA resistance proportional to the severity of the GPI anchoring defect .

  • Flow cytometry with multiple GPI-anchored protein markers: Quantitative assessment of multiple GPI-anchored proteins simultaneously provides a comprehensive measure of anchoring efficiency and helps control for protein-specific effects.

  • Biochemical fractionation: Separation of membrane-bound versus soluble forms of normally GPI-anchored proteins can quantitatively assess anchoring efficiency.

  • In vitro transamidase activity assay: Direct measurement of the ability to form carbonyl intermediates during the transamidation reaction provides a specific readout of PIG-S function .

MarkerDetection MethodSensitivitySpecificity for PIG-S
GPI-GFP/mCherryFluorescence microscopy/Flow cytometryHighModerate (affected by all GPI synthesis defects)
PA resistanceCell viability assayModerateModerate (affected by other GPI components)
Multiple GPI-anchored proteinsMulticolor flow cytometryHighModerate
Carbonyl intermediate formationIn vitro biochemical assayModerateHigh

How can researchers differentiate between PIG-S defects and other GPI transamidase component deficiencies?

Differentiating between PIG-S defects and other GPI transamidase component deficiencies requires a systematic approach:

  • Complex formation analysis: Although cells lacking PIG-U can still form complexes containing the four other components (GPI8, GAA1, PIG-S, and PIG-T), these complexes lack the ability to cleave the GPI attachment signal peptide. Similarly, specific patterns of complex formation can be observed with other component deficiencies. Immunoprecipitation followed by western blotting for each component can reveal which proteins are still able to interact in the absence of PIG-S versus other components .

  • Carbonyl intermediate formation: PIG-S knockout cells are particularly defective in the formation of carbonyl intermediates during the transamidation reaction. This specific defect can be measured through biochemical assays and compared with the phenotypes of cells deficient in other components .

  • Rescue experiments: Transfection with individual component cDNAs can determine which component is deficient. For example, if transfection with PIG-S cDNA rescues the GPI anchoring defect, it confirms a PIG-S deficiency. Cross-species complementation, such as using yeast Gpi17p to partially restore function in PIG-S deficient mammalian cells, can also provide insights into functional conservation and specificity .

  • Accumulation of GPI precursors: Different component deficiencies lead to distinct patterns of GPI precursor accumulation. PIG-S deficient cells accumulate both mature and immature GPI, which distinguishes them from cells with defects in earlier steps of GPI biosynthesis .

What criteria should be used to validate recombinant Rat PIG-S for functional studies?

Validation of recombinant Rat PIG-S for functional studies should include these critical criteria:

  • Protein expression and solubility assessment: Western blotting should confirm proper expression at the expected molecular weight. Due to its hydrophobic nature, special solubilization conditions may be necessary for optimal detection .

  • Subcellular localization: Immunofluorescence microscopy should verify correct localization to the endoplasmic reticulum, where the GPI transamidase complex functions.

  • Complex formation ability: Co-immunoprecipitation assays should demonstrate proper incorporation into the GPI transamidase complex with other components (GAA1, GPI8, PIG-T, and PIG-U).

  • Functional complementation: The recombinant protein should restore GPI anchoring in PIG-S deficient cells, as measured by:

    • Surface expression of GPI-anchored proteins

    • GPI-anchored fluorescent protein localization

    • Proaerolysin sensitivity

    • In vitro transamidase activity

  • Mutation analysis: Introduction of mutations in conserved regions should affect function in predictable ways. Of particular interest is the region with similarity to long-chain fatty acid elongases, which has been identified as functionally important in both PIG-U and its yeast ortholog Cdc91p .

  • Species-specific functionality: While there is functional conservation across species, species-specific differences should be characterized. For example, yeast Gpi17p (ortholog of PIG-S) only partially restores GPI-anchored proteins on mammalian cells lacking PIG-S .

How should researchers interpret contradictory data regarding PIG-S function across different experimental systems?

When faced with contradictory data regarding PIG-S function across different experimental systems, researchers should consider:

  • Species-specific differences: While the core function of PIG-S is conserved, orthologues like yeast Gpi17p show only partial rescue of mammalian PIG-S deficiency. This indicates that species-specific differences exist and should be accounted for when comparing results across systems .

  • Cell type variability: Different cell types may express varying levels of other GPI transamidase components or regulatory factors that influence PIG-S function. For instance, embryonic cells like F9 may respond differently to PIG-S disruption compared to differentiated cells .

  • Assay sensitivity differences: Various detection methods have different thresholds of sensitivity. The fluorescent GPI-sensor approaches may detect subtle defects in GPI anchoring that antibody-based methods might miss .

  • Technical considerations:

    • Sample preparation methods (particularly for hydrophobic proteins like PIG-S)

    • Expression levels of recombinant proteins

    • Epitope tag interference with function

    • Differences in knockout/knockdown efficiency

  • Systematic validation approach:

    • Reproduce key findings using multiple methodologies

    • Test across multiple cell types or models

    • Perform dose-response studies when using inhibitors or varying expression levels

    • Collaborate with other laboratories to verify critical findings

What are the promising approaches for studying PIG-S regulation in disease models?

Several promising approaches for studying PIG-S regulation in disease models include:

  • Patient-derived cellular models: Generating induced pluripotent stem cells (iPSCs) from patients with suspected GPI anchoring disorders and differentiating them into relevant cell types can provide disease-relevant models for studying PIG-S regulation.

  • Conditional knockout animal models: Developing tissue-specific and inducible PIG-S knockout models can help understand its role in development and disease progression without the complications of embryonic lethality that complete knockout might cause.

  • High-throughput screening: Using the fluorescent GPI-sensor systems to screen for compounds that modulate PIG-S function could identify potential therapeutic approaches for GPI anchoring disorders .

  • Integrative multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics data from models with altered PIG-S function can reveal regulatory networks and compensatory mechanisms.

  • Interaction with lipid metabolism: Given the similarity of a region in PIG-S to long-chain fatty acid elongases, investigating the relationship between lipid metabolism and PIG-S function could reveal new regulatory mechanisms .

  • Structural biology combined with molecular dynamics: Determining the structure of PIG-S alone and within the GPI transamidase complex would provide insights into its function and regulation, and could facilitate structure-based drug design for disorders involving GPI anchoring.

How might novel methodologies enhance our understanding of PIG-S function in the GPI transamidase complex?

Novel methodologies that could enhance our understanding of PIG-S function include:

  • Cryo-electron microscopy: High-resolution structural analysis of the entire GPI transamidase complex would reveal the precise arrangement and interactions of PIG-S with other components and substrates.

  • Single-molecule studies: Techniques like single-molecule FRET could provide insights into the dynamics of PIG-S within the complex during the transamidation reaction.

  • Advanced genome editing approaches: Precise modification of specific domains or residues within PIG-S using base editing or prime editing could enable detailed structure-function analysis without complete protein loss.

  • Quantitative live-cell imaging: Combining the fluorescent GPI-sensor approach with advanced microscopy techniques could allow real-time monitoring of GPI anchoring in living cells under various conditions .

  • Synthetic biology approaches: Reconstitution of minimal GPI transamidase systems with defined components could help dissect the specific contributions of PIG-S.

  • AI-assisted protein modeling: Utilizing artificial intelligence approaches like AlphaFold to predict structures and interactions of PIG-S with other components and substrates could generate testable hypotheses about function.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 fused to PIG-S could identify transient interactors and regulatory proteins in the native cellular environment.

What are the implications of PIG-S research for understanding broader cellular processes and developing therapeutic approaches?

PIG-S research has significant implications for understanding broader cellular processes and developing therapeutic approaches:

  • Protein quality control and trafficking: The GPI transamidase complex, including PIG-S, functions within the broader context of protein quality control and trafficking in the endoplasmic reticulum. Understanding PIG-S function could provide insights into these essential cellular processes.

  • Cell surface organization: GPI-anchored proteins contribute to the organization of membrane microdomains, which influence numerous cellular processes including signaling and membrane trafficking.

  • Therapeutic applications:

    • The fluorescent GPI-sensor systems developed for PIG-S research could be adapted for high-throughput screening of compounds that modulate GPI anchoring in disease states .

    • Understanding the precise function of PIG-S could enable targeted approaches to correct defects in GPI anchoring disorders.

    • PIG-S and the GPI anchoring pathway could be targets for anti-parasitic drugs, given their importance in organisms like trypanosomes .

  • Diagnostic applications: The novel PIG-A mutation assay methodology using GPI-anchored fluorescent proteins could be adapted for diagnostic purposes in conditions involving GPI anchoring defects .

  • Bioengineering applications: Knowledge of PIG-S function could enable the development of engineered cells with modified GPI anchoring capabilities for biotechnology applications.

What controls are essential when designing experiments to study PIG-S function?

When designing experiments to study PIG-S function, these controls are essential:

  • Positive controls:

    • Wild-type cells expressing normal levels of PIG-S

    • PIG-S knockout cells reconstituted with wild-type PIG-S

    • Known GPI-anchored proteins with well-characterized expression patterns

  • Negative controls:

    • PIG-S knockout or knockdown cells

    • Cells treated with inhibitors of GPI synthesis or attachment

    • Non-GPI-anchored membrane proteins (transmembrane proteins) to demonstrate specificity

  • Experimental validation controls:

    • Multiple independent PIG-S knockout or knockdown cell lines to control for off-target effects

    • Multiple detection methods for GPI-anchored proteins

    • Rescue experiments with both wild-type and mutant versions of PIG-S

  • Technical controls:

    • Loading controls for Western blots

    • Transfection efficiency controls when expressing recombinant proteins

    • Multiple timepoints for assessing phenotypes (particularly for inducible systems)

  • Cross-species controls:

    • Testing orthologs (e.g., yeast Gpi17p) in mammalian systems to assess functional conservation and specificity

    • Using recombinant proteins from different species to identify conserved functional domains

How should researchers design experiments to differentiate between structural and catalytic roles of PIG-S?

To differentiate between structural and catalytic roles of PIG-S, researchers should consider these experimental approaches:

  • Structure-function analysis:

    • Generate a series of point mutations or truncations in different domains of PIG-S

    • Assess each mutant for: (a) incorporation into the GPI transamidase complex, and (b) catalytic activity of the complex

    • Mutations that permit complex formation but abolish activity would suggest a catalytic role

  • Cross-linking and proximity analysis:

    • Use chemical cross-linking followed by mass spectrometry to identify which regions of PIG-S interact with other components

    • Employ proximity labeling techniques (BioID, APEX2) to map the spatial relationships within the complex

  • Kinetic analysis:

    • Develop in vitro assays to measure the kinetics of GPI attachment with purified complexes

    • Compare complexes with wild-type PIG-S versus various mutants to identify catalytically important residues

  • Substrate binding studies:

    • Test whether PIG-S directly interacts with either the GPI attachment signal or the lipid portion of GPI

    • This is particularly relevant given the similarity of a region in PIG-S to fatty acid elongases

  • Rescue experiments with chimeric proteins:

    • Create chimeric proteins combining domains from PIG-S and its orthologs

    • Test which domains are sufficient to restore complex formation versus enzymatic activity

Domain/RegionHypothesized FunctionExperimental ApproachExpected Outcome if CatalyticExpected Outcome if Structural
Transmembrane domainsMembrane anchoring/complex assemblyDeletion/mutation analysisComplex forms but no activityComplex fails to form
Conserved region similar to fatty acid elongasesGPI lipid recognitionTargeted mutationsReduced substrate binding/catalysisNormal complex, normal GPI binding
Species-specific regionsFine-tuning of activityCross-species chimerasAltered kinetics/specificityNormal complex formation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.