Recombinant Rat GRAM domain-containing protein 1A (Gramd1a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat GRAM Domain-Containing Protein 1A (Gramd1a)

Recombinant Rat GRAM domain-containing protein 1A (Gramd1a) is a protein encoded by the Gramd1a gene and is involved in cellular response to cholesterol . Gramd1a contains a GRAM domain, which is a protein module that binds to sterols, particularly cholesterol, and phosphoinositides . Gramd1a influences various cellular processes, including tumor growth and chemotherapy resistance .

Gene and Protein Information

The Gramd1a gene encodes a protein involved in cholesterol binding and transfer activity . Gramd1a has been identified as a key gene with potential therapeutic targets . Studies show that Gramd1a is upregulated in several types of cancer, suggesting its possible use as a biomarker .

Functional Analysis and Research Findings

  • Role in Hepatocellular Carcinoma (HCC): Gramd1a is upregulated in HCC tissues, and high levels of Gramd1a are associated with poor patient outcomes . Gramd1a promotes self-renewal of HCC stem cells, resistance to chemotherapy, and tumor growth by regulating signal transducer and activator of transcription 5 (STAT5) .

  • Role in Wilms Tumor (WT): Gramd1a is highly expressed in WT tissues, and its expression is associated with tumor progression . Silencing Gramd1a inhibits cell viability, proliferation, migration, and invasion in WT cells, indicating its potential as a therapeutic target .

GRAMD1A Expression and Clinical Significance

FeatureHCCWilms Tumor (WT)
Expression LevelUpregulated in HCC tissues Highly expressed in tumor tissues
Prognostic SignificanceUnfavorable prognostic factor Potential prognostic marker
Functional RolePromotes self-renewal of HCC stem cells, resistance to chemotherapy, and tumor growth Promotes cell viability, proliferation, migration, and invasion
Regulatory TargetSignal transducer and activator of transcription 5 (STAT5) Not specified
Therapeutic ImplicationUseful biomarker and target for HCC Potential therapeutic target

GRAMD1A and JAK/STAT Signaling Pathway

GRAM domain-containing protein 1B (GRAMD1B) is positively regulated by JAK/STAT signaling, and GRAMD1B inhibition decreases STAT3 levels, suggesting a positive feedback loop . GRAMD1B and JAK/STAT signaling act synergistically to promote gastric cancer cell survival by upregulating the expression of the anti-apoptotic molecule Bcl-xL .

ER-PM Contact Sites

GRAM domain proteins, particularly GRAMD2a, control the localization and translocation of STIM1 proteins . GRAMD2a is involved in setting up and regulating $$Ca^{2+}$$ signaling by mediating endoplasmic reticulum–plasma membrane (ER-PM) contact sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
Gramd1a; Protein Aster-A; EG1RVC; GRAM domain-containing protein 1A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-723
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Gramd1a
Target Protein Sequence
MFDTTPHSGRSSPSSSPSLRKRLQLLPPSRPPSAPEPEPGTMVEKGSDSSSEKSGVSGTL STQSLGSRNFIRNSKKMQSWYSMLCPTYKQRNEDFRKLFSKLPEAERLIVDYSCALQREI LLQGRLYLSENWICFYSNIFRWETTISIQLKEVTCLKKEKTAKLIPNAIQICTESEKHFF TSFGARDRCFLLIFRLWQNALLEKTLSPRELWHLVHQCYGSELGLTSEDEDYVCPLQLNG LGSPKEVGDVIALSDISPSGAADRSQEPSPVGSRCGRVTPNLSRASSDADHGAEEDKEDQ TDSQLDASSSQTVTPVAEPLSAEPAPPDGPTSNLGPLDLLSREELLTDTSNSSSSTGEEG DLAALLPDLSGRLLINSVFHVGAERLQQMLFSDSPFLQGFLQQRKFTDVTLSPWSSDSKC HQRRVLTYTIPISNQLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQGIPYQDYFYTAH RYCILGLARNKARLRVSSEIRYRKQPWSLVKSLIEKSSWTGIEDYFHHLDRELAKAEKVS LEEGGKDARGLLSGLRRRKRPLSWRGHRDGPQHPDPDPCTQTSMHTSGSLSSRFSEPSVD QGPGAGIPSALVLISIVLIVLIALNALLFYRLWSLERTAHTFESWHSLALAKGKFPQTAT EWAEILALQKHFHSVEVHKWRQILRASVELLDEMKFSLEKLHQGITVPDPPLDTQPHPDD SFP
Uniprot No.

Target Background

Function
GRAM domain-containing protein 1A (GRAMD1A) is a cholesterol transporter mediating non-vesicular cholesterol transfer from the plasma membrane (PM) to the endoplasmic reticulum (ER). Its unique cholesterol- and PM-binding domains act as a molecular bridge for this transfer, playing a critical role in cholesterol homeostasis. GRAMD1A's PM localization is dynamically regulated by membrane cholesterol levels; under lipid-poor conditions, it resides in the ER membrane, while excess PM cholesterol recruits it to endoplasmic reticulum-plasma membrane contact sites (EPCS) via its GRAM domain. At the EPCS, the sterol-binding VASt/ASTER domain facilitates cholesterol transfer from the PM to the ER. GRAMD1A may contribute to tumor progression and is involved in autophagy regulation, specifically autophagosome biogenesis, a function dependent on its cholesterol-transfer activity.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cell membrane; Single-pass membrane protein. Cytoplasmic vesicle, autophagosome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.