Recombinant Rat Heme transporter HRG1 (Slc48a1)

Shipped with Ice Packs
In Stock

Description

Role in Heme Transport

Heme transporter HRG1 plays a fundamental role in cellular heme acquisition, particularly in tissues and cell types requiring significant iron provision. It functions as an evolutionarily conserved transporter capable of moving heme across cellular membranes, facilitating the uptake of this essential iron-containing cofactor .

Recent research has demonstrated that HRG1 enables the direct import of both heme and fluorescent heme analogues such as zinc mesoporphyrin (ZnMP) into cells . This capacity for heme transport is critical for organisms and cell types that depend on exogenous heme sources for their metabolic requirements.

Expression in Oligodendrocytes and Myelin Formation

Surprisingly, oligodendrocytes (OLs) in the central nervous system express HRG1 at higher levels than any other cell type in both rodents and humans. This unexpected finding has significant implications for understanding iron metabolism in myelinating cells .

Detailed studies have confirmed that Hrg1 is expressed in mature oligodendrocytes but not in their precursors (OPCs). The protein colocalizes within myelin sheaths in the central nervous system white matter, suggesting a role in myelin function and maintenance .

In Hrg1 null mutant mice, researchers observed:

  1. Reduced expression of myelin associated glycoprotein (Mag)

  2. Ultrastructural myelin defects reminiscent of Mag-null animals

  3. Reduced myelin iron levels in vivo

These findings collectively suggest that oligodendrocyte HRG1 functions as a heme transporter necessary for myelin integrity. The protein appears to play a crucial role in iron provision during myelination processes, potentially through heme-dependent mechanisms .

Evolutionary Conservation and Comparative Biology

The heme transporter HRG1 demonstrates remarkable evolutionary conservation, suggesting its fundamental importance across diverse species. In parasitic nematodes like Haemonchus contortus (barber's pole worm), which lack the ability to synthesize heme de novo, HRG1 serves as an essential mechanism for acquiring heme from their host environment .

Studies in parasitic nematodes have demonstrated that HRG1:

  1. Enables heme uptake via intestinal cells

  2. Facilitates cellular heme utilization through the endo-lysosomal system

  3. Shows a conspicuous distribution at the basal laminae covering the alimentary tract, muscles, and gonads

The broader tissue expression pattern of HRG1 in parasitic nematodes compared to its orthologues in free-living nematodes indicates its critical involvement in heme homeostasis across multiple tissues and organs .

Expression and Purification

Recombinant Rat HRG1 for research applications is typically produced in E. coli expression systems. The protein is engineered with an N-terminal histidine tag to facilitate efficient purification using affinity chromatography techniques . This approach yields highly purified protein (>90% purity) suitable for various biochemical and functional assays.

Functional Assays

Recombinant Rat HRG1 serves as a valuable tool for investigating heme transport mechanisms in various experimental settings. Key applications include:

  1. In vitro heme transport assays using fluorescent heme analogues like ZnMP

  2. Studies of oligodendrocyte differentiation and myelin formation

  3. Comparative analyses of heme transport efficiency across species variants

  4. Structure-function relationships through site-directed mutagenesis

Therapeutic Potential and Target Validation

The essential nature of HRG1 in certain organisms, particularly parasitic nematodes, suggests potential therapeutic applications. RNA interference (RNAi) experiments targeting HRG1 in parasitic worms have demonstrated that:

  1. Knockdown of HRG1 results in sick and lethal phenotypes in infective larvae

  2. These effects can only be rescued by supplementation of exogenous heme in early developmental stages

  3. RNAi-treated infective larvae cannot establish infection or survive in mammalian hosts

These findings indicate that HRG1 represents a potential intervention target in parasitic nematodes, highlighting the broader significance of research on this heme transporter and its recombinant forms.

Comparative Analysis with Human HRG1

The human homolog of Rat HRG1 shares significant structural and functional similarities, though with distinct species-specific variations. The human protein:

  1. Comprises 146 amino acids, matching the length of the rat protein

  2. Is encoded by the SLC48A1 gene (UniProt ID: Q6P1K1)

  3. Is similarly produced as a recombinant protein with an N-terminal histidine tag in E. coli expression systems

Comparative studies between rat and human HRG1 provide valuable insights into the evolutionary conservation of heme transport mechanisms and species-specific adaptations in iron metabolism pathways.

Future Research Directions

Current research suggests several promising avenues for future investigation of Rat HRG1:

  1. Structural biology approaches to elucidate the three-dimensional conformation and transport mechanism

  2. Development of specific inhibitors for potential therapeutic applications in parasitic diseases

  3. Further characterization of its role in oligodendrocyte biology and myelin maintenance

  4. Investigation of potential interactions with other iron metabolism proteins in specialized tissues

These research directions will provide deeper understanding of the molecular mechanisms and physiological significance of this important heme transporter.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc48a1; Hrg1; Heme transporter HRG1; Heme-responsive gene 1 protein homolog; HRG-1; Solute carrier family 48 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc48a1
Target Protein Sequence
MAPTRLQLGVRAAYSGFSSLAGFSIFFVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYM QDYWRTWLRGLRGFFFVGALFSAVSFSAFCTFLTLAITQHQSFKDPNSYYLSCVWSFISF KWAFLLSLYAHRYRADFADISILSDF
Uniprot No.

Target Background

Function
Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.
Gene References Into Functions
  1. HRG-1 regulates V-ATPase activity, which is essential for endosomal acidification, heme binding, and receptor trafficking in mammalian cells. PMID: 19875448
Database Links
Protein Families
HRG family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is SLC48A1 and what is its primary function?

SLC48A1 (Solute Carrier Family 48 Member 1), also known as HRG1 (Heme-Responsive Gene 1), is a membrane protein that functions as a heme transporter. Its primary role is transporting heme from the lysosome to the cytoplasm, particularly in reticuloendothelial system (RES) macrophages during the recycling of senescent erythrocytes . This protein plays a crucial role in iron homeostasis, as over 65% of total body iron is located within erythrocytes in hemoglobin heme moieties . The transporter was originally discovered in Caenorhabditis elegans, with its heme transport function subsequently demonstrated in yeast models and mammalian systems .

How is recombinant Rat SLC48A1 typically produced for research use?

Recombinant Rat Heme transporter HRG1 (SLC48A1) for research applications is typically produced in E. coli expression systems . The full-length protein (amino acids 1-146) is commonly fused to an N-terminal His tag to facilitate purification. The resulting recombinant protein is isolated, purified to greater than 90% purity as determined by SDS-PAGE, and typically supplied as a lyophilized powder . For optimal storage and handling, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for long-term storage. Researchers are advised to avoid repeated freeze-thaw cycles and to store working aliquots at 4°C for up to one week .

What are the optimal conditions for working with recombinant Rat SLC48A1 in vitro?

When working with recombinant Rat SLC48A1 in vitro, researchers should consider the following optimal conditions:

ParameterRecommended ConditionNotes
Storage temperature-20°C to -80°CAliquoting is necessary for multiple use
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation prior to opening is recommended
Glycerol content5-50% final concentration50% is commonly used for long-term storage
Working temperature4°CFor short-term use (up to one week)
ApplicationsSDS-PAGE and functional assaysProtein purity >90%

For functional studies, it's important to note that SLC48A1 is a membrane protein, so incorporation into appropriate membrane mimetics may be necessary for activity assessments. The protein's stability decreases with repeated freeze-thaw cycles, so researchers should prepare single-use aliquots whenever possible.

How can researchers effectively generate SLC48A1-deficient animal models?

Based on published research, CRISPR/Cas9 gene editing has been successfully used to generate SLC48A1-deficient mouse models with high efficiency. When targeting the Slc48a1 locus, the following approach has proven effective:

  • Design multiple guide RNAs targeting early exons. In previous studies, guides targeting exon 1 showed higher editing efficiency than those targeting exon 2 .

  • Target specific regions: Guide RNAs targeting the region encoding the first transmembrane domain have generated successful knockouts .

  • Injection protocol: Inject CRISPR/Cas9 components into B6129F1 zygotes. Previous experiments achieved a 41% editing efficiency (15 mutations in 36 founder animals) .

  • Screening strategy: Analyze embryos at E14.5 for initial assessment of editing efficiency, then establish mouse lines from founders with promising mutations .

  • Mutation validation: Frame-shift mutations immediately after the first transmembrane domain (e.g., two base-pair deletion in exon 1) have successfully eliminated functional SLC48A1 protein, as confirmed by Western blotting and immunohistochemistry .

When implementing this strategy, researchers should anticipate normal Mendelian ratios for Slc48a1 frame-shift mutations, unlike some other heme-related gene knockouts that exhibit embryonic lethality .

What phenotypic changes should researchers expect in SLC48A1-deficient animal models?

Researchers working with SLC48A1-deficient animal models should anticipate several consistent phenotypic changes:

Phenotypic FeatureObservation in SLC48A1-deficient MiceTimeframe/Notes
Hemozoin accumulationDark intracellular pigments visible in RES macrophagesFirst appears at 8 days of age
Tissue appearanceDarkened spleen, bone marrow, and liverVisible by gross examination at 6 weeks
Spleen size~15% increase in spleen sizeConsistent finding across mutant lines
HematocritLower hematocrit compared to wild-typeDespite this, peripheral blood counts remain within normal range on standard diet
Iron metabolismRequires more dietary iron to maintain erythropoiesisCompared to littermate controls

It's noteworthy that despite these changes, SLC48A1-deficient mice show surprising viability with red cell indices within normal range when fed standard laboratory rodent diet (~400 ppm iron) . This viability contrasts with the embryonic lethality observed in knockouts of other genes in the heme-iron recycling pathway (HMOX1, SLC40A1, FTH1, and FLVCR1), suggesting a unique heme detoxification mechanism through hemozoin formation .

How does SLC48A1 deficiency interact with other components of the heme-iron recycling pathway?

SLC48A1 deficiency reveals complex interactions with other components of the heme-iron recycling pathway, particularly with heme oxygenase 1 (HMOX1). These interactions produce unexpected results in genetic epistasis experiments:

  • SLC48A1 knockout mice are viable, while HMOX1 knockout mice show >90% embryonic lethality .

  • Double knockout (DKO) of both SLC48A1 and HMOX1 does not rescue the embryonic lethality, contradicting simple genetic epistasis predictions .

  • Haploinsufficiency studies with HMOX1 heterozygotes (HMOX1 HET; SLC48A1 KO) show:

    • Almost 40% embryonic lethality, deviating from expected Mendelian ratios

    • Enhanced reduction in splenic red pulp macrophages (RPMs)

    • Significant reduction in Ter-119+ cells in bone marrow

    • Fewer mature Ter-119+ cells in spleen, suggesting ineffective stress erythropoiesis

These findings suggest that partial reduction of HMOX1 in the absence of SLC48A1 leads to synthetic lethality, while complete inhibition of HMOX1 causes even greater embryonic mortality . This indicates a delicate balance between heme transport and degradation pathways, and suggests that functional HMOX1 may require SLC48A1 on erythrophagosomal membranes for optimal activity.

What is the significance of hemozoin formation in SLC48A1-deficient models?

The formation of hemozoin in SLC48A1-deficient mice represents a significant and previously unknown pathway for heme detoxification in mammals. Several key points underscore its importance:

  • Novel discovery: Prior to findings in SLC48A1-deficient mice, hemozoin had only been observed in blood-feeding parasites such as Plasmodium . Its discovery in mammals represents a paradigm shift in our understanding of heme detoxification mechanisms.

  • Heme tolerance mechanism: SLC48A1-deficient mice sequester over ten-fold excess heme as crystalline hemozoin within enlarged lysosomes in RES macrophages . This sequestration renders the otherwise toxic heme relatively inert, explaining the viability of these animals despite massive heme accumulation.

  • Developmental timeline: Visible hemozoin first appears in the RES macrophages of SLC48A1-deficient mice at 8 days of age, which researchers propose correlates with the onset of erythrocyte recycling in mice . This timing provides valuable information about the developmental biology of the RES system.

  • Heme compartmentalization: While SLC48A1-deficient mice sequester heme within acidic phagolysosomes as hemozoin (promoting tolerance), HMOX1-deficient mice accumulate heme within the cytosol, resulting in cytotoxicity and embryonic lethality . This distinction highlights the importance of subcellular heme localization in determining toxicity outcomes.

This research suggests that mammals possess previously unrecognized mechanisms for managing heme toxicity, with potential implications for understanding and treating heme-related disorders.

What techniques are most effective for detecting and quantifying SLC48A1 expression?

Researchers investigating SLC48A1 expression should consider multiple complementary techniques to ensure comprehensive analysis:

TechniqueApplicationNotes
Western blottingProtein expression quantificationSuccessfully used to confirm absence of SLC48A1 protein in knockout models
ImmunohistochemistryTissue localizationEffective for detecting SLC48A1 in RES tissues like spleen and liver
RT-PCR/qPCRmRNA expressionCan detect transcripts even when protein is absent (as seen in some KO models)
Flow cytometryCell population analysisUseful for studying effects on specific cell types (e.g., Ter-119+ cells, RPMs)

When quantifying SLC48A1 protein, particular attention should be paid to tissues with high expression levels, such as spleen and liver, which contain abundant RES macrophages . For knockout validation, researchers should note that some mutations may still produce mRNA transcripts despite eliminating functional protein expression, necessitating protein-level confirmation .

How should researchers optimize experimental protocols for studying heme transport by SLC48A1?

For studying the heme transport function of SLC48A1, researchers should consider the following optimized approaches:

  • Cellular models:

    • Tissue culture models have successfully demonstrated mammalian SLC48A1 heme transport

    • Yeast heterologous expression systems provide an alternative model organism

  • Subcellular localization studies:

    • Focus on lysosomal and phagolysosomal membrane localization

    • Use co-localization with lysosomal markers to confirm proper targeting

  • Functional assays:

    • Measure heme transport from lysosomes to cytosol

    • Quantify hemozoin formation in SLC48A1-deficient cells

    • Assess iron recycling efficiency using isotopic labeling

  • In vivo approaches:

    • Use dietary iron manipulation (restriction or supplementation) to stress the heme recycling system

    • Analyze heme content in various tissues, particularly focusing on RES-rich organs

    • Employ phagocytosis assays with labeled senescent erythrocytes to track heme processing

  • Interaction studies:

    • Investigate SLC48A1's relationship with HMOX1 and other components of the heme degradation pathway

    • Consider proximity labeling techniques to identify protein interactions at the erythrophagosomal membrane

These approaches should be tailored to the specific research question, with attention to the appropriate positive and negative controls for each experimental system.

What are the critical considerations when working with recombinant SLC48A1 for structural and functional studies?

When conducting structural and functional studies with recombinant SLC48A1, researchers should address several critical considerations:

  • Protein reconstitution strategies:

    • As a multi-pass membrane protein, SLC48A1 requires appropriate membrane mimetics (detergents, nanodiscs, or liposomes) to maintain native folding and function

    • The choice of reconstitution system should reflect the protein's natural environment at the lysosomal/phagolysosomal membrane

  • Structural considerations:

    • The four transmembrane domains of SLC48A1 pose challenges for structural studies

    • Consider the impact of purification tags (e.g., His-tag) on protein folding and function

    • The conserved tyrosine and acidic-dileucine-based sorting signal in the cytoplasmic carboxy-terminus are critical structural features to preserve

  • Functional assay design:

    • Establish appropriate pH gradients mimicking the acidic lysosomal environment

    • Include relevant cofactors that may facilitate heme transport

    • Consider the directionality of transport (import vs. export) in experimental setup

  • Quality control checkpoints:

    • Verify protein integrity after reconstitution using biochemical and biophysical methods

    • Assess proper folding using limited proteolysis or spectroscopic techniques

    • Confirm heme-binding capabilities using spectroscopic methods

  • Storage and stability:

    • Maintain proteins in appropriate buffer conditions (e.g., Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

    • Add glycerol (typically 50%) for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles to prevent protein degradation and aggregation

Addressing these considerations will enhance the reliability and physiological relevance of research findings related to SLC48A1 structure and function.

How should researchers interpret hemozoin formation in mammalian systems compared to parasitic organisms?

The interpretation of hemozoin formation in mammalian systems requires careful consideration of several factors that distinguish it from the well-studied parasitic hemozoin:

  • Evolutionary context:

    • Hemozoin formation in blood-feeding parasites like Plasmodium evolved as a specialized detoxification mechanism

    • In contrast, mammalian hemozoin formation appears to be an adaptive response to SLC48A1 deficiency rather than a primary physiological process

  • Formation mechanism differences:

    • In parasites, hemozoin formation is an enzymatically assisted process within food vacuoles

    • In SLC48A1-deficient mammals, hemozoin likely forms spontaneously in the acidic environment of the phagolysosome when heme concentration exceeds a critical threshold

  • Temporal dynamics:

    • Mammalian hemozoin first appears at 8 days after birth, coinciding with the onset of erythrocyte recycling

    • This timing provides valuable insights into developmental hematology and the maturation of iron recycling systems

  • Physiological consequences:

    • While parasitic hemozoin formation is essential for parasite survival

    • Mammalian hemozoin represents an alternative detoxification pathway that becomes relevant only when the primary pathway (SLC48A1-mediated heme transport) is compromised

  • Research implications:

    • The discovery challenges the notion that hemozoin is exclusive to blood-feeding organisms

    • Suggests potential therapeutic approaches for conditions involving heme toxicity

    • May provide insights into evolutionary connections between mammalian and parasitic heme handling mechanisms

When interpreting hemozoin data in mammalian systems, researchers should consider these distinctive aspects rather than applying paradigms directly from parasitology literature.

What controls and validation steps are essential when studying SLC48A1 knockout phenotypes?

For rigorous investigation of SLC48A1 knockout phenotypes, researchers should implement the following essential controls and validation steps:

  • Genotypic validation:

    • Confirm gene editing at the DNA level through sequencing

    • Verify absence of SLC48A1 protein using Western blotting and immunohistochemistry in multiple tissues

    • Check for potential compensatory upregulation of related genes

  • Phenotypic controls:

    • Use multiple independent knockout lines to confirm phenotype consistency (as demonstrated with lines M6, M4, B10, and B13)

    • Include littermate controls to minimize genetic background effects

    • Consider heterozygote animals to evaluate potential gene dosage effects

  • Dietary controls:

    • Standardize iron content in diets (e.g., ~400 ppm for standard laboratory rodent diet)

    • Include dietary manipulation experiments to stress the system and reveal potential compensatory mechanisms

  • Hematological validation:

    • Perform complete blood counts including red cell indices

    • Analyze bone marrow and splenic erythropoiesis using flow cytometry

    • Quantify specific cell populations such as red pulp macrophages (RPMs)

  • Biochemical confirmation:

    • Verify hemozoin presence using multiple detection methods (histology, spectroscopy)

    • Quantify tissue iron content to assess iron homeostasis

    • Measure heme oxygenase activity to evaluate compensatory responses

  • Genetic interaction studies:

    • Generate compound mutants (e.g., with HMOX1) to understand pathway interactions

    • Compare phenotypes with knockouts of other heme/iron pathway components

    • Create tissue-specific knockouts to dissect cell-autonomous versus non-autonomous effects

These controls and validation steps will strengthen the reliability and interpretability of research findings related to SLC48A1 deficiency.

What are the emerging research questions about SLC48A1 that remain to be addressed?

Despite significant advances in understanding SLC48A1 function, several important research questions remain unexplored:

  • Structural mechanisms of heme transport:

    • What is the molecular mechanism by which SLC48A1 transports heme across the lysosomal membrane?

    • How do the four transmembrane domains and conserved residues contribute to transport function?

    • What is the importance of the conserved tyrosine and acidic-dileucine-based sorting signal in the cytoplasmic carboxy-terminus?

  • Regulatory mechanisms:

    • How is SLC48A1 expression regulated in response to heme and iron availability?

    • What transcription factors and signaling pathways control SLC48A1 levels?

    • Are there post-translational modifications that regulate SLC48A1 activity?

  • Pathophysiological relevance:

    • Are there human diseases associated with SLC48A1 variants or dysfunction?

    • Could targeting SLC48A1 be therapeutic in conditions of iron overload or heme toxicity?

    • Might SLC48A1 dysfunction contribute to unexplained cases of anemia or iron disorders?

  • Hemozoin biology in mammals:

    • What factors determine whether excess heme forms hemozoin in mammals?

    • Are there enzymes or proteins that facilitate hemozoin formation in mammalian lysosomes?

    • Could hemozoin formation be harnessed therapeutically to mitigate heme toxicity?

  • Evolutionary aspects:

    • How has SLC48A1 function evolved across species?

    • What explains the expansion to four paralogs in C. elegans compared to a single homolog in mammals?

    • Is there evolutionary conservation in the mechanisms of hemozoin formation between parasites and mammals?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and clinical research to fully elucidate the role of SLC48A1 in heme and iron homeostasis.

How might research on SLC48A1 contribute to understanding and treating heme-related disorders?

Research on SLC48A1 has significant potential to advance our understanding and treatment of various heme-related disorders:

  • Hemochromatosis and iron overload conditions:

    • Understanding SLC48A1's role in iron recycling could provide insights into how to modulate iron accumulation

    • The discovery that SLC48A1-deficient mice require more dietary iron suggests potential compensatory mechanisms that could be therapeutically targeted

  • Hemolytic anemias:

    • SLC48A1's role in heme recycling following erythrophagocytosis makes it relevant to conditions with increased red cell destruction

    • Pharmacological enhancement of SLC48A1 function might improve iron recycling efficiency in states of ineffective erythropoiesis

  • Malaria and parasitic diseases:

    • The unexpected connection between mammalian and parasitic hemozoin formation opens new comparative biology approaches

    • Understanding differences and similarities between these processes might reveal novel antiparasitic strategies

  • Heme toxicity conditions:

    • The discovery that hemozoin formation protects against heme toxicity in SLC48A1-deficient mice suggests potential detoxification approaches

    • This mechanism might be relevant to conditions involving cell-free hemoglobin or heme, such as sickle cell disease and certain hemolytic disorders

  • Macrophage dysfunction:

    • SLC48A1's importance in RES macrophage function suggests it may influence macrophage-related pathologies

    • The relationship between SLC48A1 and HMOX1 points to complex regulatory mechanisms in macrophage heme handling that could be therapeutically targeted

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.