Recombinant Rat Hereditary hemochromatosis protein homolog (Hfe)

Shipped with Ice Packs
In Stock

Description

Functional Role in Iron Homeostasis

Hfe regulates systemic iron balance by modulating hepcidin, a liver-derived hormone that inhibits iron absorption . Key mechanisms include:

  • Interaction with Transferrin Receptors:

    • Binds TfR1 and TfR2, competing with transferrin for TfR1 binding .

    • Displacement from TfR1 by iron-saturated transferrin triggers hepcidin upregulation .

  • Hepcidin Regulation:

    • Hfe knockout (Hfe⁻/⁻) mice exhibit hepatic iron overload and suppressed hepcidin mRNA .

    • Hepatocyte-specific Hfe overexpression restores hepcidin levels, correcting iron overload .

In Vitro Studies

  • Hepcidin Promoter Activation: Recombinant Hfe enables mechanistic studies of TfR2/Hfe-dependent hepcidin expression in HepG2 cells .

  • Protein-Protein Interactions: Used to map Hfe-TfR binding domains (e.g., α3 domain critical for TfR2 interaction) .

Animal Models

  • Iron Overload Phenotypes: Hfe⁻/⁻ rats and mice replicate HH hallmarks, including elevated transferrin saturation (96% vs. 77% in wild types) and hepatocyte iron deposition .

  • Dietary Iron Responses: Liver Hfe protein content decreases during iron deficiency, correlating with hepcidin suppression .

Key Findings from Rodent Models

ModelPhenotype/OutcomeReference
Hfe⁻/⁻ Mice8-fold hepatic iron accumulation; <16% hepcidin mRNA levels
Iron-Deficient Rats50% reduction in liver Hfe protein; hepcidin downregulation
TfR1 MutantsImpaired Hfe-TfR1 binding mimics Hfe⁻/⁻ iron overload

Pathophysiological Relevance

  • Hereditary Hemochromatosis: The C282Y mutation in human HFE disrupts TfR interactions, causing unchecked iron absorption .

  • Therapeutic Targets: Restoring Hfe-TfR2 signaling corrects hepcidin deficiency in HH models .

Unresolved Questions

  • Hfe in Non-Parenchymal Cells: While Hfe is highly expressed in liver sinusoidal endothelial cells, its role there remains unclear .

  • Matriptase-2 Interaction: No evidence supports Hfe cleavage by matriptase-2, despite its role in iron-refractory anemia .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Hfe; Hereditary hemochromatosis protein homolog; RT1-CAFE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-360
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Hfe
Target Protein Sequence
QALRPGSHSLRYLFMGASKPDLGLPFFEALGYVDDQLFVSYNHESRRAEPRAPWILGQTSSQLWLQLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLRVVPESHILQVILGCEVHEDNSTSGFWKYGYDGQDHLEFCPKTLNWSAAEPRAWATKMEWEEHRIRARQSRDYLQRDCPQQLKQVLELQRGVLGQQVPTLVKVTRHWASTGTSLRCQALNFFPQNITMRWLKDSQPLDAKDVNPENVLPNGDGTYQGWLTLAVAPGEETRFSCQVEHPGLDQPLTATWEPSRSQDMIIGIISGITICAIFFVGILILVLRKRKVSGGTMGDYVLTECE
Uniprot No.

Target Background

Function
HFE protein binds to the transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.
Gene References Into Functions
  1. The identification of HFE gene expression in rat hepatocytes raises intriguing questions about its role in hepatocyte iron metabolism. PMID: 12927914
  2. HFE gene expression was primarily localized in hepatocytes. PMID: 14563638
  3. HFE co-localized exclusively with the terminal web of intestinal enterocytes. HFE expression was increased in iron deficiency, suggesting a second regulatory role for HFE in iron absorption, independent of hepcidin from the liver. PMID: 16208485
Database Links
Protein Families
MHC class I family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is the structure and function of Rat HFE protein?

Rat Hereditary hemochromatosis protein homolog (HFE) is a non-classical MHC Ib molecule that, unlike typical MHC molecules, does not appear to have antigen-binding capabilities . Structurally, HFE contains multiple domains including extracellular (α1-α3) and transmembrane domains, with several splice variants that result in isoforms potentially lacking one or more of these domains . The protein is ubiquitously expressed throughout the body, though expression levels vary significantly between tissues . Quantitative analysis has shown that the liver comprises the highest levels of full-length HFE but has the lowest transcript levels of alternative HFE splice variants .

Functionally, HFE primarily regulates iron metabolism by interacting with transferrin receptor 1 (TfR1). This interaction reduces TfR1's affinity for transferrin (Tf), thereby downregulating iron uptake . Additionally, HFE interacts with TfR2 through its α3 domain, forming part of a signaling pathway that controls hepcidin expression, which is central to systemic iron homeostasis regulation .

How does Rat HFE differ from human HFE in structure and function?

While rat and human HFE proteins share considerable homology, there are notable differences in their structure and functional interactions. The rat HFE protein (UniProt ID: O35799, Gene ID: 29199) maintains the core functional domains present in human HFE but exhibits species-specific variations in amino acid sequences that may affect binding affinity to partners like TfR1 and TfR2 .

What are the key splice variants of Rat HFE and their tissue distribution?

Rat HFE is expressed in various splice variants with distinct tissue distribution patterns, suggesting differential functions based on tissue type . Several splice variants result in isoforms that may lack one or all of the extracellular (α1-α3) or transmembrane domains . Quantitative mRNA expression analysis has revealed that the liver comprises the highest levels of full-length HFE transcripts while simultaneously showing the lowest levels of alternative HFE splice variants .

This differential expression pattern is particularly significant for researchers, as it suggests that experimental design should carefully consider which splice variant is most relevant to the tissue or biological process under investigation. When working with recombinant Rat HFE, researchers should specify which splice variant they are using and consider how this choice might impact their experimental outcomes, especially in tissue-specific studies.

How does the interaction between Rat HFE and transferrin receptors mediate iron homeostasis?

Rat HFE participates in a complex regulatory network controlling iron homeostasis through its interactions with both transferrin receptor 1 (TfR1) and transferrin receptor 2 (TfR2). HFE associates with TfR1 through its α1 and α2 domains and with TfR2 through its α3 domain . The binding sites on TfR1 for HFE and iron-loaded transferrin (holo-Tf) overlap, confirming competition between HFE and holo-Tf for binding to TfR1 .

In hepatocytes, which are central to systemic iron regulation, HFE appears to function upstream of hepcidin expression . When iron levels rise, increased holo-Tf competes with HFE for binding to TfR1, potentially releasing HFE to interact with TfR2. Co-immunoprecipitation studies have demonstrated that TfR1 co-immunoprecipitates with HFE in the absence of added holo-Tf but not in the presence of high physiological levels of holo-Tf . Conversely, TfR2 co-immunoprecipitates with HFE in the presence of high physiological levels of holo-Tf (25 μM) .

This dynamic interaction network suggests that HFE may participate in a sensing mechanism for iron levels, where high iron conditions (represented by high holo-Tf) cause HFE to shift from TfR1 to TfR2, potentially initiating signaling that increases hepcidin expression to reduce further iron absorption.

What experimental approaches can differentiate between HFE-TfR1 and HFE-TfR2 interactions in cellular models?

To differentiate between HFE-TfR1 and HFE-TfR2 interactions in cellular models, researchers can employ several complementary approaches:

  • Mutant HFE expression systems: The W81AHFE mutant has 5,000-fold lower affinity for TfR1 but still binds to TfR2 . Experiments comparing wild-type HFE and W81AHFE can help distinguish the roles of these interactions. For instance, in HepG2 cells, W81AHFE expression resulted in similar increases in hepcidin transcription compared to wild-type HFE, suggesting that HFE-TfR1 interaction is not required for Tf-dependent induction of hepcidin expression .

  • Co-immunoprecipitation under controlled Tf conditions: By immunoprecipitating HFE and probing for co-precipitated proteins under different holo-Tf concentrations, researchers can observe the dynamic shifts in HFE binding partners. TfR1 co-immunoprecipitates with HFE in the absence of added holo-Tf but not in the presence of high physiological levels of holo-Tf, while TfR2 co-immunoprecipitates with HFE in the presence of high holo-Tf levels .

  • Cell lines with differential expression of HFE, TfR1, and TfR2: Comparing responses in cell lines with different expression levels of these proteins can provide insights into their interactions. For example, WIF-B cells had 32-fold higher HFE mRNA levels and 8-fold higher TfR2 mRNA levels compared to HepG2 cells, correlating with differential hepcidin responses to holo-Tf .

These approaches, alone or in combination, can help researchers delineate the specific contributions of HFE-TfR1 and HFE-TfR2 interactions to iron sensing and hepcidin regulation.

How does HFE contribute to immunological functions beyond iron metabolism?

While HFE is primarily known for its role in iron metabolism, substantial evidence suggests it has significant immunological functions. As a non-classical MHC Ib molecule, HFE appears to be involved in antigen presentation pathways despite lacking antigen-binding capabilities . Cross-talk between HFE and the antigen presentation pathway has been shown to impair antigen processing and T cell activation .

Studies have demonstrated that HFE can shape the T cell repertoire, evidenced by imbalanced CD4/CD8 ratios in hereditary hemochromatosis (HH) patients with HFE mutations . Furthermore, HFE has been described as a skin tolerance antigen in pre-clinical models, with implications for autoimmunity .

The immunological functions of HFE may be linked to its iron regulatory role, as iron levels can influence immune cell function. Alternatively, HFE may have direct effects on immune processes independent of iron regulation. Researchers studying recombinant Rat HFE should consider designing experiments that can distinguish between iron-dependent and iron-independent immunological functions, potentially using iron chelators or iron supplementation in conjunction with immunological readouts.

What are the optimal conditions for detecting Rat HFE using ELISA techniques?

When using ELISA techniques to detect Rat HFE, researchers should consider several technical parameters to ensure optimal results:

Test Range and Sensitivity: Commercial Rat HFE ELISA kits typically have a test range of 0.78 ng/ml - 50 ng/ml with a sensitivity of < 0.27 ng/ml . For accurate results, sample concentrations should be diluted to mid-range of the kit.

Sample Preparation: Rat HFE can be detected in tissue homogenates, cell lysates, and other biological fluids . When preparing samples, it's essential to use appropriate lysis buffers that preserve protein structure while effectively extracting HFE from membranes. Protease inhibitors should be included to prevent degradation.

Assay Type and Format: Sandwich ELISA with colorimetric detection is typically used for Rat HFE quantification . This format provides good specificity and sensitivity for detecting native HFE protein.

Sample Dilution Optimization: The optimal dilution should be determined empirically for each sample type, as recommended by kit manufacturers . A dilution series is advisable for initial experiments to identify the appropriate range.

Storage and Handling: ELISA kits for Rat HFE are typically shipped at 4°C and may be in lyophilized form . Proper reconstitution and storage according to the kit's manual is crucial for maintaining reactivity and specificity.

It's important to note that ELISA kits are optimized for detection of native samples rather than recombinant proteins, which may have different sequences or tertiary structures compared to the native protein . This could affect the detection of recombinant Rat HFE in experimental settings.

What expression systems are most effective for producing functional recombinant Rat HFE?

The choice of expression system for recombinant Rat HFE production is critical for obtaining functional protein. Based on the literature and technical considerations, several systems offer advantages:

Mammalian Expression Systems: Cell lines like HEK293 or CHO cells are often preferred for expressing Rat HFE as they provide proper post-translational modifications, particularly glycosylation, which may be important for HFE function and stability. These systems allow for the production of recombinant HFE that closely resembles the native protein in terms of folding and modifications.

Inducible Expression Systems: Tetracycline-regulated expression systems, as used in the HepG2/tTA HFE cell line, can be particularly useful for controlled expression of Rat HFE . This approach allows researchers to compare cells with and without HFE expression in the same genetic background, facilitating the study of HFE-specific effects.

Considerations for Functional Studies: When expressing recombinant Rat HFE for functional studies, it's important to consider the cellular context. For iron metabolism studies, hepatic cell lines like WIF-B or HepG2 that express other components of the iron-sensing machinery (such as TfR1, TfR2, and machinery for hepcidin expression) may provide a more physiologically relevant environment .

Verification of Functionality: Regardless of the expression system chosen, verification of the recombinant protein's functionality is essential. This can include assessing binding to known partners like TfR1 and TfR2 through co-immunoprecipitation experiments, or functional readouts like the ability to modulate hepcidin expression in appropriate cellular contexts .

How can researchers effectively analyze HFE splice variants in experimental settings?

Analysis of HFE splice variants presents unique challenges due to their tissue-specific expression patterns and potentially distinct functions. Several methodological approaches can be employed:

Transcript Analysis:

  • Quantitative RT-PCR using primer sets specific to different exons or exon junctions can quantify the expression levels of various splice variants.

  • RNA-seq analysis with appropriate bioinformatic pipelines can provide comprehensive profiling of all splice variants present in a sample.

  • Northern blotting can be useful for visualizing the size distribution of HFE transcripts, though it offers lower sensitivity than PCR-based methods.

Protein Analysis:

  • Western blotting with antibodies targeting different domains of HFE can detect variant-specific protein expression.

  • Immunoprecipitation followed by mass spectrometry can identify HFE isoforms and their interacting partners.

  • Immunofluorescence microscopy can reveal the subcellular localization of different HFE variants, which may provide insights into their functions.

Functional Characterization:

  • Overexpression of specific splice variants in cellular models can help determine their individual functions.

  • CRISPR-Cas9 editing to selectively disrupt specific exons can help elucidate the roles of different domains in HFE function.

  • Co-immunoprecipitation studies can identify variant-specific protein interactions, particularly with TfR1 and TfR2 .

When designing experiments to study HFE splice variants, researchers should consider the tissue-specific expression patterns, as the liver has been shown to have the highest levels of full-length HFE but the lowest transcript levels of alternative HFE splice variants . This suggests that experimental design should be tailored to the specific tissue context being investigated.

How does HFE genotype influence experimental outcomes in rat models of iron overload?

The HFE genotype significantly impacts experimental outcomes in rat models of iron overload, affecting iron accumulation patterns, hepcidin regulation, and physiological responses. Understanding these genotype-dependent effects is crucial for experimental design and data interpretation.

Primary hepatocytes isolated from wild-type, Hfe−/−, and Tfr2245X/245X mice show different hepcidin responses to holo-Tf treatment . This indicates that genetic background influences how hepatocytes respond to iron signals, which has implications for studying iron overload in different rat strains or genetic models.

When designing iron overload studies in rats with different HFE genotypes, researchers should consider:

  • Baseline Iron Parameters: Different HFE genotypes will have different baseline iron levels, which should be measured and accounted for in experimental design.

  • Strain-Specific Responses: Background strain can significantly influence iron metabolism. For example, Hfe−/− mice on the 129/SvEvTac background and Tfr2 mice on a FVB/NJ background show different fold increases in hepcidin mRNA levels (3.4-fold vs. 9.9-fold) in response to treatment with 25 μM holo-Tf .

  • Compensatory Mechanisms: Long-term adaptation to altered HFE function may lead to compensatory changes in other iron regulatory pathways, which should be considered when interpreting results.

  • Tissue-Specific Effects: The consequences of HFE variations may differ across tissues, necessitating comprehensive tissue analysis rather than focusing solely on liver parameters.

What are the best approaches for analyzing contradictory data regarding HFE's role in infectious disease susceptibility?

Contradictory findings regarding HFE's role in infectious disease susceptibility, such as those seen in SARS-CoV-2 infection studies , require careful methodological approaches to resolve:

How can researchers integrate HFE functional data with broader iron metabolism pathways in experimental design?

Integrating HFE functional data with broader iron metabolism pathways requires a systems biology approach that considers multiple interacting components:

  • Multi-Omics Integration: Combining transcriptomic, proteomic, and metabolomic data can provide a comprehensive view of how HFE functions within iron metabolism networks. This approach can reveal unexpected connections and compensatory mechanisms that might not be apparent from studying HFE in isolation.

  • Pathway Analysis with HFE as a Central Node: Experimental designs should consider HFE's interactions with multiple partners, including:

    • Transferrin receptors (TfR1 and TfR2)

    • Hepcidin regulatory pathways

    • Iron transport systems

    • Inflammatory signaling pathways

  • Temporal Dynamics of HFE-Dependent Responses: Iron regulatory systems respond dynamically to changing conditions. Time-course experiments examining HFE interactions and downstream effects can provide insights into the sequential events in iron sensing and regulation.

  • Cell Type-Specific Experimental Design: Different cell types express varying levels of HFE and its interaction partners. Experimental designs should account for these differences by:

    • Comparing hepatic cell lines with different expression profiles of iron-related genes

    • Using primary cells from different tissues

    • Developing co-culture systems to study cell-cell communication in iron regulation

  • Integration of HFE's Dual Roles in Iron Metabolism and Immunity: Experimental designs should incorporate readouts for both iron parameters and immune function to capture the full spectrum of HFE's biological roles. This is particularly relevant given that HFE has been implicated in antigen presentation and T cell repertoire shaping .

What are the most promising approaches for studying the relationship between HFE and hepcidin regulation?

The relationship between HFE and hepcidin regulation represents a critical aspect of iron homeostasis, with several promising research directions:

  • Advanced Cell Models: Developing more sophisticated cell models that recapitulate the hepatic microenvironment could provide better insights into HFE-mediated hepcidin regulation. Hepatic cell lines like WIF-B and HepG2 transfected with HFE have shown that hepcidin expression responds to iron-loaded transferrin , but three-dimensional organoid cultures or co-culture systems might better mimic in vivo conditions.

  • Protein Complex Characterization: HFE appears to form different protein complexes under varying iron conditions, shifting from TfR1 to TfR2 when iron levels are high . Advanced proteomics approaches, such as BioID or APEX proximity labeling, could identify all components of these complexes and how they change in response to iron levels.

  • Signaling Pathway Analysis: The pathways connecting HFE-TfR2 interaction to hepcidin transcription remain incompletely understood. Phosphoproteomic analysis combined with specific pathway inhibitors could help delineate the signaling cascades involved.

  • Temporal Dynamics: Real-time imaging of fluorescently tagged HFE, TfR1, and TfR2 could reveal the kinetics of complex formation and dissociation in response to changing iron levels, providing insights into the temporal aspects of iron sensing.

  • Genetic Approaches: CRISPR-Cas9 editing to create specific mutations in HFE binding domains could help dissect the contribution of different protein interactions to hepcidin regulation. This approach has been partially implemented with mutations like W81AHFE that disrupt TfR1 binding , but could be extended to other interaction interfaces.

How might the role of HFE in antigen presentation be further investigated in rat models?

The emerging role of HFE in antigen presentation pathways presents an exciting area for further investigation in rat models:

  • Comparative Immunology Approaches: Comparing immune responses in wild-type rats versus those with HFE mutations or HFE knockout could reveal how HFE shapes the immune system. This should include analysis of:

    • T cell repertoire development

    • Antigen presentation efficiency

    • Immune cell activation thresholds

    • Responses to specific antigens

  • Cross-talk Between Iron Status and Immune Function: Experiments manipulating both HFE function and iron levels could help determine whether HFE's immunological effects are mediated through iron or represent independent functions. This could involve iron chelation or supplementation in rats with different HFE genotypes.

  • Tissue-Specific HFE Manipulation: Given HFE's variable expression across tissues, conditional knockout or overexpression models targeting specific cell types (hepatocytes, macrophages, dendritic cells) could help dissect the cell-specific roles of HFE in immune function.

  • Molecular Interaction Studies: Investigating how HFE interacts with components of the antigen processing machinery could provide mechanistic insights. This might include co-immunoprecipitation studies, proximity labeling, or in vitro reconstitution of antigen processing systems with and without HFE.

  • Disease Model Applications: Testing how HFE variants affect susceptibility and responses to autoimmune diseases, infections, or tumors in rat models could reveal the broader implications of HFE's immunological functions. This is particularly relevant given observations that HFE has been implicated in shaping autoimmune responses and may be exploited by tumors to evade immune surveillance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.