Recombinant Rat High affinity copper uptake protein 1 (Slc31a1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Slc31a1; Copt1; Ctr1; High affinity copper uptake protein 1; Copper transporter 1; rCTR1; Liver regeneration-related protein LRRGT00200; Solute carrier family 31 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVI NTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTV GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVV DITEHCH
Uniprot No.

Target Background

Function
High-affinity, saturable copper transporter involved in dietary copper uptake.
Gene References Into Functions

High-affinity Copper Transporter 1 (CTR1) Function:

  1. CTR1 and ATP7A are crucial for copper transport in choroidal epithelial cells. Lead (Pb) exposure alters CTR1 and ATP7A expression, leading to intracellular copper accumulation. (PMID: 24316150)
  2. CTR1 facilitates the transport and accumulation of copper salts (CuCl2; CuSO4) and organoplatinum compounds in dorsal root ganglion neurons, contributing to the neurotoxicity of certain antineoplastic drugs. (PMID: 23123662)
  3. Adult rat dorsal root ganglion (DRG) tissue exhibits a distinct expression pattern of copper transporters, with neuronal subsets expressing either ATP7A or CTR1, but not both or ATP7B. (PMID: 20836889)
  4. Apical CTR1 localization in intestinal epithelia suggests an adaptive response to modulate copper absorption under dietary copper limitation. (PMID: 20699218)
  5. CTR1 mRNA and immunoreactivity in astrocyte cultures suggest its role in copper accumulation. (PMID: 20004225)
  6. SLC31A1 gene activity correlates with the formation rates of intracellular and extracellular copper-containing enzymes. (PMID: 16637264)
  7. Prolactin stimulates copper transport by increasing CTR1 and ATP7A abundance at the mammary gland plasma membrane. (PMID: 16741141)
Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Localizes to the apical membrane in intestinal epithelial cells.

Q&A

What expression systems are most effective for producing recombinant rat Slc31a1?

For recombinant expression of rat Slc31a1, several systems have proven effective depending on the research application:

  • Mammalian expression systems: HEK293 cells are particularly effective for expressing functional rat Slc31a1, as demonstrated in studies examining copper and platinum drug uptake . This system allows for proper protein folding and post-translational modifications that maintain transporter functionality.

  • Bacterial expression systems: While E. coli systems can produce high yields of recombinant protein, membrane proteins like Slc31a1 often require specialized strains and conditions for proper expression.

  • Yeast expression systems: S. cerevisiae can be used for heterologous expression, particularly useful when studying functional complementation in yeast CTR1 mutants.

For optimal expression of functional recombinant rat Slc31a1, the following methodological considerations are crucial:

  • Use of appropriate signal sequences to ensure proper membrane localization

  • Incorporation of purification tags that do not interfere with transporter function

  • Expression under copper-limited conditions to prevent protein degradation or internalization

  • Verification of functional activity through copper uptake assays post-expression

How can Slc31a1 expression levels be accurately measured in rat tissue samples?

Accurate measurement of Slc31a1 expression in rat tissue samples can be achieved through several complementary approaches:

  • ELISA-based detection: Specialized rat Slc31a1 ELISA kits offer high sensitivity (approximately 0.172 ng/mL) and specificity for quantifying protein levels in serum, plasma, tissue homogenates, and cell culture supernatants. These assays typically employ a sandwich ELISA format with detection ranges of 0.312-20 ng/mL .

  • Quantitative PCR (qPCR): For mRNA expression analysis, qPCR using Slc31a1-specific primers offers a reliable method for relative quantification across different tissue samples. This approach is particularly useful for examining transcriptional regulation under various physiological conditions .

  • Immunohistochemistry: This technique allows for visualization of Slc31a1 localization within tissue sections, providing important information about subcellular distribution and expression patterns across different cell types within complex tissues .

  • Western blotting: For semi-quantitative protein analysis, western blotting using specific anti-Slc31a1 antibodies can detect the protein in tissue lysates, although membrane protein extraction requires specialized protocols to maintain protein integrity.

When comparing expression across tissues, normalization to appropriate housekeeping genes or proteins is essential for accurate interpretation of results.

How do knockout or knockdown models of rat Slc31a1 affect copper homeostasis compared to other species?

Studies of Slc31a1 knockout/knockdown models reveal complex, tissue-specific effects on copper homeostasis with notable species comparisons:

In rats specifically, Slc31a1 knockdown affects copper distribution in a tissue-dependent manner. Comparative analysis between species shows that while complete Slc31a1 knockout is embryonically lethal in mice (occurring around day 10 of gestation), heterozygous knockout mice exhibit tissue-specific copper deficiencies . Brain and spleen copper levels in these heterozygous mice are approximately 50% lower than in wild-type controls, demonstrating that both Slc31a1 alleles are necessary for maintaining proper copper levels in these organs .

Tissue-specific knockout studies further illuminate Slc31a1's role:

  • Liver-specific Slc31a1 knockout in mice results in severe copper accumulation defects and impaired copper-dependent biochemical pathways

  • Heart-specific knockouts similarly show deficiencies in copper-dependent functions

  • Intestine-specific Slc31a1 deficiency demonstrates its critical role in dietary copper absorption

Importantly, even in Slc31a1 knockout cells, alternative copper transport mechanisms maintain approximately one-third of normal copper levels, suggesting compensatory pathways. These include DMT1 (DCT1, Nramp2)-mediated transport of Cu(II) rather than Cu(I), representing a mechanistically distinct copper acquisition pathway .

Researchers should consider these compensatory mechanisms when designing Slc31a1 knockout experiments, as complete copper transport inhibition may require targeting multiple transporters simultaneously.

What methodologies can distinguish between Slc31a1-mediated copper transport and alternative copper uptake pathways in rat cells?

Distinguishing between Slc31a1-mediated and alternative copper transport pathways requires sophisticated experimental approaches:

  • Metal specificity profiling: Slc31a1 preferentially transports Cu(I), while alternative pathways like DMT1 transport Cu(II). Experimental designs using specific oxidation states of copper can help differentiate these pathways. For example, experiments performed in the presence of reducing agents like ascorbate will favor Slc31a1-mediated transport .

  • Competitive inhibition assays: Slc31a1-mediated copper transport is competitively inhibited by silver and zinc ions. Experiments demonstrating transport inhibition by these metals (particularly at low temperatures) strongly indicate Slc31a1 involvement . Specifically:

    • Silver ions (Ag+) act as potent competitive inhibitors

    • Zinc ions (Zn2+) show moderate competitive inhibition

    • Temperature reduction to 4°C significantly reduces Slc31a1-mediated transport

  • Saturation kinetics analysis: Slc31a1-mediated transport demonstrates saturable kinetics with distinct Km values compared to other transporters. Transport assays using increasing copper concentrations can generate Lineweaver-Burk plots that distinguish between high-affinity (Slc31a1) and low-affinity transport systems .

  • Platinum drug cross-reactivity: Unique to Slc31a1, platinum-based drugs (oxaliplatin, cisplatin) share the transport pathway. Competitive inhibition between copper and platinum drugs occurs in Slc31a1-expressing cells but not in cells utilizing alternative copper transport mechanisms .

A comprehensive experimental approach combining these methodologies provides the most reliable differentiation between Slc31a1-dependent and independent copper transport in rat cells.

What are the optimal conditions for assessing Slc31a1-mediated platinum drug transport in rat neuronal cultures?

Optimizing conditions for studying Slc31a1-mediated platinum drug transport in rat neuronal cultures requires careful experimental design:

  • Culture system selection: Dorsal root ganglion (DRG) neurons represent an excellent model system for studying platinum drug transport, as they endogenously express rCtr1 on neuronal cell body plasma membranes and are affected by platinum-induced neurotoxicity .

  • Transport assay parameters:

    • Temperature control is crucial: assays should be performed at both 37°C and 4°C, as Slc31a1-mediated transport is temperature-dependent

    • Medium composition should be carefully controlled for metal ion content

    • Platinum drug concentration ranges should span from 1-100 µM to capture saturation kinetics

    • Exposure times typically range from 1-24 hours, with shorter exposures revealing initial uptake rates

    • Cold platinum versus radioactive platinum methodologies each offer distinct advantages for quantification

  • Inhibitor applications: To confirm Slc31a1 specificity:

    • Pre-treatment with copper (0.1-10 µM) should competitively inhibit platinum uptake in HEK/rCtr1 cells, though this effect may be variable in neuronal cultures

    • Silver and zinc pre-treatments provide additional confirmation of Slc31a1 involvement

  • Analytical measurements:

    • Platinum accumulation can be quantified using inductively coupled plasma mass spectrometry (ICP-MS)

    • Cell viability assays (MTT, calcein-AM) should be performed in parallel to correlate transport with cytotoxicity

    • Immunocytochemistry for Slc31a1 can confirm transporter expression and localization

Interestingly, research has shown that while platinum drug uptake in HEK/rCtr1 cells is inhibited by copper, this inhibition pattern may differ in DRG neurons, suggesting tissue-specific regulatory mechanisms for Slc31a1-mediated transport .

How does the role of Slc31a1 in copper transport correlate with its emerging function in acute myocardial infarction (AMI)?

Recent research has identified a potential connection between Slc31a1 function and acute myocardial infarction (AMI) pathophysiology through several mechanisms:

  • Mitochondrial energy production: Copper is essential for electron transport chain function, particularly for cytochrome c oxidase activity. Research indicates that Slc31a1-mediated copper transport plays a critical role in maintaining mitochondrial energy production, which is particularly important in high-energy-demanding cardiac tissue .

  • Cuproptosis pathway involvement: Slc31a1 has been identified as a contributor to cuproptosis, a newly identified cell death mechanism. Comprehensive bioinformatics analytics have suggested that Slc31a1 expression may be a key factor in AMI's pathophysiology through this pathway .

  • Immune landscape modulation: Correlation analysis between immune cell types and Slc31a1 expression, performed using the Spearman method, has revealed potential immunomodulatory roles for this transporter in cardiac tissue during ischemic events .

  • Diagnostic biomarker potential: Advanced machine learning models incorporating Slc31a1 expression data have demonstrated promise for improving AMI diagnostic accuracy, suggesting its utility as an emerging biomarker .

Researchers investigating this connection should consider:

  • Temporal expression patterns of Slc31a1 following experimental myocardial infarction in rat models

  • Correlation between copper levels, Slc31a1 expression, and cardiac function parameters

  • Potential therapeutic interventions targeting copper homeostasis in cardiac disease contexts

These findings highlight the expanding role of Slc31a1 beyond basic copper transport to include significant functions in cardiovascular pathophysiology.

What are the most effective methods for studying the physical and functional interactions between rat Slc31a1 and other copper metabolism proteins?

Studying physical and functional interactions between rat Slc31a1 and other copper metabolism proteins requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP) assays: This technique can identify physical interactions between Slc31a1 and potential partner proteins such as copper chaperones (e.g., ATOX1, CCS) or other transporters. For membrane proteins like Slc31a1, specialized protocols using mild detergents (0.5-1% digitonin or 0.1% DDM) better preserve protein-protein interactions .

  • Proximity ligation assays (PLA): This technique can visualize protein interactions in situ with high sensitivity, particularly useful for detecting transient interactions between Slc31a1 and copper chaperones during metal transfer events.

  • FRET/BRET approaches: Fluorescence or bioluminescence resonance energy transfer techniques can detect protein interactions in living cells by tagging Slc31a1 and potential partners with appropriate fluorophores or luciferase.

  • Functional complementation studies: These assess whether rat Slc31a1 can rescue phenotypes in cells or organisms lacking specific copper metabolism proteins, revealing functional relationships.

  • Copper flux assays: These measure how copper movement across membranes is affected by the presence or absence of specific copper metabolism proteins when Slc31a1 is present.

  • Subcellular localization studies: Co-localization analysis through confocal microscopy can reveal spatial relationships between Slc31a1 and other copper metabolism proteins.

Several key relationships that warrant investigation include:

  • Interactions between Slc31a1 and ATOX1 (cytosolic copper chaperone)

  • Potential relationship with SLC31A1P1, the processed gene homologous to SLC31A1

  • Functional coordination with ATP7A/ATP7B copper exporters

  • Interactions with copper storage proteins like metallothioneins

Understanding these interactions provides critical insight into the complete copper transport pathway from cellular uptake to utilization in cuproenzymes.

What are common pitfalls in measuring copper transport activity of recombinant rat Slc31a1 and how can they be avoided?

Researchers commonly encounter several challenges when measuring copper transport activity of recombinant rat Slc31a1:

  • Copper contamination issues:

    • Pitfall: Background copper in media and buffers can mask true transport activity

    • Solution: Use certified metal-free reagents, plastic labware instead of glass, and chelating resins to prepare copper-free buffers; establish reliable baseline measurements

  • Protein degradation and trafficking problems:

    • Pitfall: Recombinant Slc31a1 may be improperly folded or trafficked, especially in heterologous systems

    • Solution: Verify protein localization via immunofluorescence or cell surface biotinylation; confirm appropriate glycosylation status; use epitope tags that don't interfere with trafficking

  • Copper oxidation state control:

    • Pitfall: Slc31a1 specifically transports Cu(I), but copper readily oxidizes to Cu(II) in aerobic solutions

    • Solution: Include appropriate reducing agents (ascorbate) in transport buffers; perform experiments under nitrogen atmosphere when possible; prevent copper oxidation with stabilizing ligands

  • Endogenous transporter background:

    • Pitfall: Many cell lines express endogenous copper transporters that confound recombinant Slc31a1 activity measurements

    • Solution: Use appropriate control cells (vector-transfected); perform parallel experiments with Slc31a1-specific inhibitors; consider CRISPR-Cas9 knockout of endogenous transporters

  • Transport vs. binding distinction:

    • Pitfall: Surface binding of copper to Slc31a1 can be mistaken for transport

    • Solution: Distinguish between binding and transport with temperature-controlled experiments (4°C vs. 37°C); use membrane-impermeable copper chelators to remove surface-bound copper

A carefully designed experimental protocol should include:

  • Time course measurements to distinguish initial rates from equilibrium

  • Concentration gradients to determine transport kinetics

  • Multiple washing steps with appropriate chelators

  • Paired viability measurements to account for toxicity effects

  • Appropriate positive controls (known Slc31a1 substrates like silver)

How can recombinant rat Slc31a1 be effectively used to study platinum drug resistance mechanisms?

Recombinant rat Slc31a1 provides a valuable tool for investigating platinum drug resistance mechanisms through several methodological approaches:

  • Expression system optimization:

    • Stable expression of rat Slc31a1 in HEK293 cells (HEK/rCtr1) has been successfully used to study platinum drug uptake

    • Inducible expression systems allow controlled modulation of transporter levels to mimic resistance development

    • Co-expression with other transporters or copper chaperones can reveal cooperative effects

  • Transport assay design:

    • Comparative uptake studies with cisplatin, oxaliplatin, and carboplatin reveal drug-specific transport kinetics

    • Competition assays with copper and other metals help identify binding site interactions

    • Temperature-dependent uptake studies distinguish between active transport and passive diffusion

  • Resistance model development:

    • Chronic exposure of Slc31a1-expressing cells to platinum drugs can generate resistance models

    • Site-directed mutagenesis of key residues in recombinant Slc31a1 can identify regions critical for platinum drug recognition

    • Correlation between Slc31a1 expression levels and platinum sensitivity provides insights into resistance thresholds

  • Clinical correlation approaches:

    • Comparing platinum drug sensitivity between wild-type and Slc31a1-overexpressing cells informs therapeutic window calculations

    • Platinum accumulation assays in cells expressing Slc31a1 variants can identify transport-deficient mutations potentially relevant to clinical resistance

Research has shown that heterologous expression of rCtr1 in HEK293 cells increases both the uptake and cytotoxicity of copper, oxaliplatin, cisplatin, and carboplatin compared to control cells, underscoring its importance in platinum drug action . Understanding the molecular details of this transport process may lead to strategies for overcoming resistance, such as developing Slc31a1-targeted approaches to enhance platinum drug delivery.

What are the best methodologies for comparing copper handling between rat Slc31a1 and human SLC31A1 in experimental systems?

Comparing copper handling between rat Slc31a1 and human SLC31A1 requires methodologies that account for both structural and functional differences:

  • Parallel expression systems:

    • Isogenic cell lines expressing either rat or human transporters under identical promoters ensure comparable expression levels

    • Lentiviral transduction systems with selectable markers allow stable, controlled expression

    • Epitope tagging at non-functional domains enables precise quantification of protein levels

  • Functional comparative assays:

    • Radioactive copper (64Cu) uptake studies provide direct quantitative comparison of transport rates

    • Copper-dependent cell growth in copper-limited conditions tests functional complementation

    • Competition studies with other metals reveal species-specific binding preferences

    • Copper efflux rates after loading cells with copper assess potential differences in transporter directionality

  • Structural comparison approaches:

    • Chimeric proteins combining domains from rat and human transporters help identify regions responsible for functional differences

    • Site-directed mutagenesis targeting non-conserved residues can identify species-specific functional determinants

    • Protein topology mapping using substituted cysteine accessibility method (SCAM) can reveal structural differences

  • Regulatory comparison methods:

    • Promoter-reporter constructs can identify species differences in transcriptional regulation

    • Protein stability and degradation assays under varying copper conditions reveal post-translational regulatory differences

    • Trafficking studies using fluorescently tagged transporters assess differences in membrane localization and internalization rates

Despite high sequence homology between rat and human transporters (approximately 90% amino acid identity), subtle differences exist that may affect:

  • Copper transport kinetics (Km and Vmax values)

  • Sensitivity to inhibitors

  • Protein-protein interactions with copper chaperones

  • Responsiveness to copper-dependent endocytosis

These comparative approaches provide valuable insights for translating findings from rat models to human clinical applications.

How should researchers interpret discrepancies in Slc31a1 expression data between different experimental methods?

When facing discrepancies in Slc31a1 expression data across different experimental methods, researchers should consider systematic methodological factors that may explain these differences:

  • Transcriptional vs. translational discrepancies:

    • qPCR measures mRNA levels while western blotting and ELISA detect protein

    • Post-transcriptional regulation may cause mRNA and protein levels to diverge

    • Solution: Use multiple methods targeting different expression levels (mRNA, protein, activity) and analyze correlation patterns

  • Antibody-related variations:

    • Different antibodies target distinct epitopes that may be differentially accessible

    • Conformational changes or post-translational modifications can mask epitopes

    • Solution: Validate antibodies using positive and negative controls; use multiple antibodies targeting different regions; confirm specificity with knockout samples

  • Sample preparation effects:

    • Membrane protein extraction efficiency varies between protocols

    • Detergent choice significantly affects Slc31a1 solubilization and detection

    • Solution: Standardize extraction protocols; use detergent screening to optimize conditions; include membrane fraction markers as controls

  • Methodological sensitivity differences:

    • ELISA (detection limit ~0.172 ng/mL) offers greater sensitivity than western blotting

    • Immunohistochemistry provides localization data but limited quantification

    • Solution: Select methods appropriate for expected expression levels; use more sensitive techniques for low-expression tissues

  • Normalization strategies:

    • Different housekeeping references may show variable stability across conditions

    • Solution: Validate multiple reference genes/proteins for each experimental context; consider absolute quantification approaches

When reporting discrepant data, researchers should:

  • Clearly document methodological details that might influence results

  • Consider copper status of samples, as this affects Slc31a1 expression and localization

  • Acknowledge limitations of each technique

  • Integrate findings across methods to develop a more complete understanding

What statistical approaches are most appropriate for analyzing Slc31a1 knockout/knockdown effects across different rat tissue types?

When analyzing Slc31a1 knockout/knockdown effects across different rat tissues, selecting appropriate statistical approaches is crucial for valid interpretation:

  • Two-way ANOVA with post-hoc testing:

    • Ideal for simultaneously analyzing the effects of genotype (knockout vs. wild-type) and tissue type

    • Allows detection of interaction effects where the impact of Slc31a1 knockout varies by tissue

    • Post-hoc tests (Tukey's, Bonferroni, or Sidak) enable pairwise comparisons while controlling for multiple testing

    • Example application: Comparing copper levels across brain, liver, heart, and kidney in Slc31a1+/+ vs. Slc31a1+/- rats

  • Linear mixed-effects models:

    • Appropriate when handling repeated measurements or when animals contribute multiple tissue samples

    • Accounts for within-subject correlations that simple ANOVA cannot address

    • Allows inclusion of covariates that might influence tissue-specific responses

    • Example application: Longitudinal studies tracking copper-dependent enzyme activities across multiple tissues and timepoints

  • Non-parametric alternatives:

    • Kruskal-Wallis followed by Dunn's test when data violate normality assumptions

    • Particularly important for small sample sizes typical in knockout studies

    • Example application: Comparing platinum drug accumulation in tissues where uptake shows high variability

  • Power analysis considerations:

    • Tissue-specific effects often show different effect sizes

    • A priori power calculations should be based on the smallest expected effect size

    • For Slc31a1 studies, brain and spleen typically show larger effects than other tissues (approximately 50% reduction in heterozygous knockouts)

  • Multiple endpoint correction:

    • When analyzing multiple copper-dependent pathways or enzymes (SOD1, cytochrome c oxidase, ceruloplasmin)

    • False Discovery Rate (FDR) control often preferred over family-wise error rate methods due to related biological endpoints

For comprehensive tissue comparison studies, researchers should consider:

  • Including tissue copper concentration, copper-dependent enzyme activities, and Slc31a1 expression as complementary endpoints

  • Reporting effect sizes in addition to p-values

  • Using data visualization approaches that highlight tissue-specific patterns (heatmaps, radar plots)

  • Correlating phenotypic changes with copper concentration changes to establish causality

How can researchers effectively integrate Slc31a1 functional data with broader copper homeostasis mechanisms in rat models?

Integrating Slc31a1 functional data with broader copper homeostasis mechanisms requires sophisticated approaches that connect multiple regulatory levels:

  • Systems biology modeling:

    • Mathematical modeling of copper flux through multiple transporters (Slc31a1, ATP7A/B, CTR2)

    • Parameter estimation using data from multiple experimental conditions

    • Sensitivity analysis to identify rate-limiting steps in copper homeostasis

    • Example approach: Ordinary differential equation models of copper movement between cellular compartments

  • Multi-omics integration strategies:

    • Combine Slc31a1 expression/function data with:

      • Transcriptomics: Expression patterns of other copper-related genes

      • Proteomics: Abundance of copper-binding proteins

      • Metabolomics: Levels of copper-dependent metabolites

      • Metallomics: Total and exchangeable copper pools

    • Integration methods include principal component analysis, partial least squares discriminant analysis, and weighted gene correlation network analysis

  • Temporal analysis approaches:

    • Time-course experiments tracking copper distribution following alteration of Slc31a1 function

    • Dynamic functional studies measuring copper-dependent enzyme activities over time

    • Analysis using time-series statistical methods rather than single-timepoint comparisons

  • Pathway impact analysis:

    • Measure effects of Slc31a1 modulation on:

      • Antioxidant pathways (SOD1 activity)

      • Energy metabolism (cytochrome c oxidase)

      • Iron metabolism (ceruloplasmin, hephaestin)

      • Connective tissue formation (lysyl oxidase)

    • Use pathway enrichment tools specifically incorporating metal cofactor dependencies

  • Physiological challenge models:

    • Copper deficiency/excess challenges reveal compensatory capacity

    • Acute versus chronic manipulations distinguish adaptive responses

    • Cross-talk with other metal homeostasis pathways (iron, zinc) reveals integration points

When reporting integrated analyses, researchers should:

  • Clearly distinguish direct versus indirect effects of Slc31a1 modulation

  • Consider tissue-specific copper requirements and baseline copper status

  • Acknowledge the temporal dynamics of copper redistribution following Slc31a1 alterations

  • Place findings within the broader context of mammalian copper homeostasis

This integration provides a more complete understanding of how Slc31a1 functions within the complex network of copper metabolism and can reveal non-intuitive regulatory relationships that single-focus approaches might miss.

How is Slc31a1 involved in cuproptosis and what methodologies best study this connection in rat models?

The emerging connection between Slc31a1 and cuproptosis—a recently identified copper-dependent cell death mechanism—represents an exciting research frontier with specific methodological considerations for rat models:

  • Cuproptosis pathway analysis:

    • Recent research has identified Slc31a1 as a key contributor to a cuproptosis-related diagnostic model for acute myocardial infarction

    • Evidence suggests that energy production within mitochondria strongly links to heart disease development through cuproptosis mechanisms

    • These findings highlight the central role of Slc31a1 expression in modulating tissue-specific sensitivity to copper-induced cell death

  • Recommended methodological approaches:

    • Transcriptomic profiling: RNA sequencing of rat tissues with varying Slc31a1 expression levels can identify co-regulated genes involved in the cuproptosis pathway

    • Mitochondrial function assays: Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) measurements in Slc31a1-modulated cells reveal metabolic alterations preceding cuproptosis

    • Protein-protein interaction studies: Co-immunoprecipitation followed by mass spectrometry can identify Slc31a1 interactions with key cuproptosis mediators

    • Live-cell imaging: Using copper-specific fluorescent probes with mitochondrial markers to visualize copper redistribution during cuproptosis initiation

  • Tissue-specific investigation approaches:

    • Cardiac models: The connection between Slc31a1, cuproptosis, and acute myocardial infarction makes cardiomyocytes a priority target for investigation

    • Neuronal models: Dorsal root ganglion neurons with high endogenous Slc31a1 expression offer an excellent system to study copper-dependent cell death mechanisms

    • Hepatic models: The liver's central role in copper homeostasis makes hepatocytes important for understanding physiological regulation of cuproptosis

  • Intervention studies:

    • Copper chelator administration can test the copper-dependence of observed cell death

    • Slc31a1 overexpression or knockdown reveals transporter-specific effects

    • Mitochondrial protectants can help distinguish cuproptosis from other cell death mechanisms

These approaches will help elucidate the specific role of Slc31a1 in regulating cellular copper levels that may trigger cuproptosis under pathological conditions, potentially leading to novel therapeutic strategies for conditions involving dysregulated copper metabolism.

What are the newest methodologies for studying the role of Slc31a1 in platinum drug neurotoxicity in rat models?

Cutting-edge methodologies for investigating Slc31a1's role in platinum drug neurotoxicity in rat models combine advanced techniques from neuroscience, pharmacology, and molecular biology:

  • Advanced neuronal culture systems:

    • Microfluidic chambers: Allow separation of neuronal cell bodies from axons, enabling localized platinum drug application and transport studies

    • 3D organoid cultures: Provide more physiologically relevant models than traditional 2D cultures

    • Co-culture systems: Incorporate supporting cells (Schwann cells, satellite glia) to better mimic in vivo DRG environment

    • Ex vivo DRG slice cultures: Preserve tissue architecture while allowing experimental manipulation

  • High-resolution imaging approaches:

    • Super-resolution microscopy: Reveals Slc31a1 nanoscale distribution and clustering

    • Correlative light and electron microscopy (CLEM): Combines functional imaging with ultrastructural analysis

    • Platinum-specific detection methods: Using fluorescent platinum sensors or LA-ICP-MS imaging to visualize platinum distribution at subcellular resolution

  • Genetic manipulation techniques:

    • CRISPR-Cas9 editing: For precise modification of Slc31a1 in primary neurons

    • AAV-mediated gene delivery: For in vivo modification of Slc31a1 expression in specific neuronal populations

    • Conditional knockout models: For temporal control of Slc31a1 expression during platinum treatment

    • Single-cell sequencing: To identify cell-type specific responses to platinum drugs in heterogeneous DRG cultures

  • Functional assessment methodologies:

    • Electrophysiological recordings: To detect early changes in neuronal excitability following platinum exposure

    • Calcium imaging: To monitor neuronal activity patterns in real-time

    • Mitochondrial function assays: To assess energetic consequences of platinum accumulation

    • Behavioral testing: To correlate molecular findings with functional outcomes in vivo

  • Therapeutic intervention approaches:

    • Slc31a1 modulators: To test whether transporter inhibition protects against neurotoxicity

    • Targeted drug delivery: Using nanoparticles that bypass Slc31a1-dependent uptake

    • Combination therapies: Testing neuroprotective agents with platinum drugs

How can researchers best study the role of Slc31a1 in rat models of copper-related neurological disorders?

Investigating Slc31a1's role in copper-related neurological disorders requires specialized approaches that address the unique challenges of neural tissue:

  • Advanced disease modeling approaches:

    • Conditional Slc31a1 knockout in specific neuronal populations: Using Cre-LoxP systems driven by neuron-specific promoters (TH, ChAT, GFAP)

    • Copper chelation and supplementation paradigms: To model conditions of copper deficiency and overload relevant to neurological disorders

    • Aging models: To study progressive changes in neuronal copper handling, as many copper-related disorders are age-dependent

    • Combined genetic models: Crossing Slc31a1 mutants with neurodegenerative disease models (Alzheimer's, Parkinson's, ALS)

  • Region-specific analysis techniques:

    • Laser capture microdissection: For isolating specific brain regions for copper content analysis

    • Region-specific viral delivery: For localized Slc31a1 manipulation

    • Brain slice electrophysiology: To assess functional consequences of altered copper homeostasis

    • Tissue clearing and 3D imaging: For whole-brain analysis of copper distribution and Slc31a1 expression

  • Copper-detection methodologies:

    • X-ray fluorescence microscopy: For high-resolution mapping of copper distribution in brain tissue

    • Electron paramagnetic resonance (EPR): For determining copper oxidation states in vivo

    • Copper-sensitive fluorescent probes: For real-time visualization of copper dynamics

    • LA-ICP-MS imaging: For quantitative copper mapping with cellular resolution

  • Behavioral and functional assessments:

    • Cognitive testing batteries: To detect subtle neurological deficits

    • Motor function assessments: Particularly relevant for extrapyramidal disorders linked to copper dysregulation

    • Seizure susceptibility testing: As copper imbalances can affect neuronal excitability

    • Neurophysiological recordings: In vivo electrophysiology to detect functional network alterations

  • Translational approaches:

    • Cerebrospinal fluid (CSF) biomarker development: For monitoring copper status and Slc31a1 function

    • PET imaging with copper radioisotopes: For non-invasive assessment of brain copper handling

    • Blood-brain barrier models: To study copper transport across this critical interface

Research shows that Slc31a1 heterozygous knockout mice have approximately 50% less copper in the brain compared to controls, indicating both alleles are necessary for proper copper uptake in neural tissue . Understanding how Slc31a1 variants or dysfunction contribute to conditions such as neurodegeneration, myelination disorders, and seizures could provide new therapeutic approaches for these challenging neurological conditions.

How should researchers reconcile contradictory findings regarding the role of Slc31a1 in platinum drug sensitivity?

When confronting contradictory findings about Slc31a1's role in platinum drug sensitivity, researchers should implement a systematic approach to reconcile these inconsistencies:

When reporting reconciled findings, researchers should:

This approach transforms apparent contradictions into opportunities for deeper understanding of the complex and context-dependent roles of Slc31a1 in platinum drug sensitivity.

What explains the differential sensitivity of rat tissues to Slc31a1 deficiency despite its ubiquitous expression?

The puzzling observation that rat tissues show differential sensitivity to Slc31a1 deficiency despite its ubiquitous expression can be explained through several complementary mechanisms:

  • Tissue-specific copper requirements:

    • Metabolic demand variation: Tissues with high mitochondrial density (heart, brain) have greater copper requirements for cytochrome c oxidase function

    • Cuproenzyme expression patterns: Tissues expressing multiple copper-dependent enzymes face compounded effects from copper limitation

    • Proliferation rates: Rapidly dividing tissues may be more sensitive to growth-limiting copper deficiency

  • Compensatory transporter expression:

    • Alternative uptake pathway variation: DMT1 and ZIP proteins may provide compensatory copper uptake in some tissues but not others

    • Baseline expression differences: Tissues with naturally higher expression of alternative transporters show greater resilience to Slc31a1 deficiency

    • Adaptive upregulation capacity: Some tissues may more readily increase expression of alternative transporters

  • Copper storage and mobilization mechanisms:

    • Metallothionein levels: Tissues with higher metallothionein expression have greater copper storage capacity

    • Ceruloplasmin utilization: Tissues that can efficiently extract copper from ceruloplasmin may be less dependent on direct Slc31a1-mediated uptake

    • Copper recycling efficiency: Tissues with efficient internal copper recycling pathways show greater resilience

  • Developmental timing effects:

    • Critical periods: Some tissues have developmental windows requiring precise copper levels

    • Compensatory pathway maturation: Alternative transport systems may develop at different rates across tissues

    • Embryonic versus postnatal requirements: Tissues with high embryonic copper demands may be affected differently than those with primarily adult requirements

  • Methodological detection sensitivity:

    • Apparent tissue differences may partly reflect varying sensitivities of assay methods

    • Subtle functional deficits may go undetected in some tissues

    • Tissue copper content may not directly correlate with functional copper availability

Research specifically shows that in Slc31a1 heterozygous knockout mice, brain and spleen copper levels are approximately 50% lower than in controls, while other tissues maintain more normal levels . This suggests both Slc31a1 alleles are necessary for copper uptake specifically in these organs, while other tissues have compensatory mechanisms .

Understanding these tissue-specific differences is crucial for predicting potential side effects of Slc31a1-targeting therapies and for developing tissue-directed interventions for copper-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.