Recombinant Rat High affinity immunoglobulin epsilon receptor subunit gamma (Fcer1g)

Shipped with Ice Packs
In Stock

Description

Introduction and Nomenclature

Fcer1g, also known as High affinity immunoglobulin epsilon receptor subunit gamma, is an adapter protein that functions as a critical component in immune signaling cascades. The recombinant form of this rat protein is extensively used in research settings to investigate immune system functions and pathologies. This protein is known by several alternative names including Fc receptor gamma-chain, FcRgamma, Fc-epsilon RI-gamma, and IgE Fc receptor subunit gamma . The gene encoding this protein in rats is officially designated as Fcer1g, with the alternative designation Fce1g sometimes used in the literature .

Evolutionary Conservation

The Fcer1g protein demonstrates considerable interspecies conservation, with the rat variant showing significant homology to its human counterpart. The human FCER1G consists of 86 amino acids encoded by the FCER1G gene, suggesting evolutionary preservation of this important immunological component . This conservation underscores the fundamental role of this protein in immune system function across mammalian species.

Protein Structure

Fcer1g contains an immunoreceptor tyrosine-based activation motif (ITAM) that serves as the foundational element for its signaling capabilities . This motif is essential for transducing activation signals from various immunoreceptors to downstream signaling cascades. The rat Fcer1g protein is encoded in the genome of Rattus norvegicus (Norway rat) and functions as a key adapter component in multiple receptor complexes .

Immunological Signaling

Fcer1g functions primarily as an adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors . Its multi-faceted roles in immune signaling include:

  1. Mediating allergic inflammatory signaling in mast cells as a component of the high-affinity IgE receptor

  2. Selectively facilitating interleukin-4 production by basophils that prime T-cells toward the effector T-helper 2 subset

  3. Associating with pattern recognition receptors CLEC4D and CLEC4E to form functional signaling complexes in myeloid cells

Cellular Activation Pathways

Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to the receptor complex containing Fcer1g leads to phosphorylation of its ITAM domain, triggering activation of SYK, CARD9, and NF-kappa-B . This activation cascade drives maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes, demonstrating Fcer1g's central role in adaptive immune response development .

Cooperative Receptor Functions

Fcer1g does not function in isolation but rather operates cooperatively with other activating receptors in the immune system. It is functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation and is also involved in integrin alpha-2/ITGA2-mediated platelet activation . This cooperative functionality highlights its versatility in different cellular contexts and signaling pathways.

Recombinant Expression Systems

Recombinant Rat Fcer1g can be produced in various expression systems, each offering distinct advantages depending on the intended application:

Expression SystemAdvantagesTypical Applications
E. ColiHigh yield, cost-effectiveBasic research, antibody production
YeastPost-translational modificationsFunctional studies
BaculovirusComplex protein expressionStructural studies
Mammalian CellNative-like modificationsCell-based assays, therapeutic research

The choice of expression system significantly impacts the protein's folding, post-translational modifications, and biological activity, making system selection crucial for specific research applications .

Quality Control Methods

Rigorous quality control is essential for ensuring the reliability and reproducibility of research utilizing Recombinant Rat Fcer1g. Standard quality control procedures include:

  1. SDS-PAGE analysis for purity assessment (typically ≥85%)

  2. Western blot verification of identity

  3. Endotoxin testing for cell culture applications

  4. Functional assays to confirm biological activity

Immunological Research Tools

Recombinant Rat Fcer1g serves as a valuable tool in numerous research applications:

  1. Enzyme-linked Immunosorbent Assays (ELISA) for quantitative protein analysis

  2. Western Blot applications as a recombinant protein standard

  3. Antibody production for developing research and diagnostic reagents

  4. Protein array experiments for high-throughput screening

Clinical Research Relevance

While the search results focus primarily on rat Fcer1g, research on the human homolog FCER1G provides insight into potential clinical applications. Recent studies have demonstrated FCER1G's significance as a prognostic marker in glioma, where higher expression levels correlate with greater malignancy and poorer prognosis .

In multivariate analysis of glioma patients, the hazard ratio of FCER1G expression (Low versus High) was 0.66 with a 95% CI of 0.54 to 0.79 (P < 0.001), indicating its potential value as a prognostic biomarker . This finding suggests that understanding the basic biology of Fcer1g through research with the recombinant rat protein may contribute to translational applications in human disease contexts.

Cancer Biology

The expression level of FCER1G increases with glioma malignancy, showing significant elevation in WHO grade III and IV compared to grade II tumors . This progressive increase suggests involvement in malignant transformation or tumor progression mechanisms, potentially identifying it as a therapeutic target.

Immune Response Regulation

As a component of the high-affinity IgE receptor, Fcer1g plays a critical role in allergic inflammatory signaling in mast cells . This function makes it relevant to research on allergic conditions and potentially positions it as a target for therapeutic intervention in allergic disorders.

Additionally, its role in integrating signals from pattern recognition receptors highlights its importance in innate immune responses, particularly against microbial pathogens . This function suggests potential applications in infectious disease research and therapeutic development.

Experimental Design Factors

When incorporating Recombinant Rat Fcer1g into experimental protocols, several factors warrant consideration:

  1. Appropriate concentration ranges for specific assay types

  2. Buffer compatibility for maintaining protein stability

  3. Potential carrier protein effects on downstream applications

  4. Validation of cross-reactivity when used in detection systems

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Fcer1g; Fce1g; High affinity immunoglobulin epsilon receptor subunit gamma; Fc receptor gamma-chain; FcRgamma; Fc-epsilon RI-gamma; IgE Fc receptor subunit gamma; FceRI gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-86
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKADIASREKSDAVYTGLNTRNQETYETLKHEKPPQ
Uniprot No.

Target Background

Function
FcεRIγ is an adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. It plays a crucial role in mediating allergic inflammatory signaling in mast cells as a component of the high-affinity IgE receptor. Furthermore, as a constitutive component of the interleukin-3 receptor complex, it selectively mediates interleukin-4 (IL-4) production by basophils, influencing T-cell differentiation towards the T helper 2 (Th2) subset. FcεRIγ also associates with the pattern recognition receptors CLEC4D and CLEC4E in myeloid cells, forming a signaling complex. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this complex triggers ITAM phosphorylation, activating SYK, CARD9, and NF-κB, leading to antigen-presenting cell maturation and shaping T-cell priming towards Th1 and Th17 subtypes. FcεRIγ may cooperate with other activating receptors and is functionally linked to integrin β2-mediated neutrophil activation and integrin α2-mediated platelet activation.
Gene References Into Functions
  1. This study indicates that CCL2, NF-κB1, RAC2, FCER1G, and C1Q contribute to neuropathic pain development after sciatic nerve injury through immune and defense pathways. PMID: 28033741
  2. This research suggests that the Mincle/MCL/FcεRIγ complex represents the functionally optimal form for these C-type lectin receptors on myeloid cell surfaces. PMID: 23921530
  3. Substitution of FcRγ T22 with non-polar amino acids does not impair FcεRI surface expression or signaling capacity. PMID: 22964482
  4. Phospholipase D1 activity, by regulating phosphatidic acid formation, controls early signaling events initiated by FcεRI aggregation, leading to mast cell degranulation. PMID: 15339843
  5. Proteins binding to phosphorylated β-ITAM of FcεRIβ include Syk, Grb2, Shc, SHIP, and SHP-1, independent of prior cell activation. PMID: 17365510
Database Links
Protein Families
CD3Z/FCER1G family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in leukocytes and pinealocytes. Expression in the pineal gland does not undergo circadian variations.

Q&A

What is Fcer1g and what are its primary functions in rat models?

Fcer1g is a critical signal-transducing subunit that plays an essential role in chronic inflammatory programs. Located on chromosome 1q23.3, it encodes the γ subunit of the fragment crystallizable (Fc) region of immunoglobulin. The binding between the Fc of immunoglobulins and the Fc receptor of immune cells activates cellular effector functions that may trigger inflammatory responses, immune cell activation, phagocytosis, oxidative burst, and cytokine release . In rat models, Fcer1g is primarily involved in allergic reactions and immune responses, functioning as a key molecule in the transduction of activation signals from various immunoreceptors .

How is recombinant rat Fcer1g typically produced for research applications?

Recombinant rat Fcer1g is typically produced through molecular cloning techniques using expression vectors. The process generally involves:

  • Isolation of rat Fcer1g cDNA from appropriate tissue samples

  • PCR amplification with specific primers containing restriction enzyme sites

  • Cloning into expression vectors (such as lentiviral vectors like VVPW)

  • Transfection into host cells (commonly 293T cells)

  • Collection and purification of the expressed protein

For lentiviral expression systems, packaging plasmids (like psPAX2) and envelope plasmids (like pCMV-VSV-G) are combined with the Fcer1g-containing plasmid and transfected into host cells. The viral particles are then collected from cell supernatants after 48-72 hours post-transfection .

What detection methods are available for quantifying rat Fcer1g in biological samples?

Several methods are available for detecting and quantifying rat Fcer1g in biological samples:

  • ELISA (Enzyme-Linked Immunosorbent Assay): Sandwich ELISA kits are commercially available with a detection range of 0.312-20 ng/ml and sensitivity of <0.15 ng/ml. These are suitable for tissue homogenates, cell lysates, and other biological fluids .

  • Western Blotting: Proteins are resolved on SDS-PAGE gels under native or reducing/denaturing conditions, transferred to membranes, and probed with specific antibodies. Anti-FLAG tag antibodies can be used if the recombinant protein is FLAG-tagged .

  • Immunoprecipitation: Using specific antibodies (such as anti-FLAG for tagged proteins) to isolate Fcer1g-containing complexes from cell lysates .

  • qPCR: For quantifying mRNA expression levels of Fcer1g in cells or tissues .

What biological specimens are appropriate for Fcer1g research in rat models?

Based on established protocols, the following biological specimens are appropriate for Fcer1g research:

Specimen TypeSuitabilityProcessing MethodNotes
Tissue homogenatesHighMechanical disruption followed by lysisPreserves protein interactions
Cell lysatesHighDetergent-based lysisGood for in vitro studies
Serum/PlasmaMediumDirect analysis or immunoprecipitationRequires sensitive detection methods
Other biological fluidsMediumVaries by fluid typeMay require concentration

For optimal results, tissue homogenates and cell lysates should be prepared using appropriate buffers containing protease inhibitors to prevent degradation of Fcer1g .

How can Fcer1g knockout models be developed and validated for functional studies?

Developing and validating Fcer1g knockout models involves several critical steps:

  • Targeting Strategy Design: The Fcer1g gene can be targeted in embryonic stem (ES) cells, as demonstrated in the development of Fcer1g mouse models. The targeting construct typically contains a selection marker (e.g., neomycin resistance) flanked by homologous sequences to the Fcer1g gene .

  • ES Cell Targeting and Screening: Following transfection of ES cells with the targeting construct, positive clones are selected and screened for proper integration using PCR and Southern blotting.

  • Blastocyst Injection and Chimera Production: Successfully targeted ES cells are injected into blastocysts (commonly C57BL/6) to generate chimeric animals .

  • Germline Transmission and Backcrossing: Chimeric animals are bred to establish germline transmission. Heterozygotes are then intercrossed to generate homozygous knockout animals. For rat models, backcrossing to the desired genetic background is typically required for at least 10 generations to ensure genetic homogeneity .

  • Validation Methods:

    • Genotyping: PCR-based confirmation of the targeted allele

    • Transcript analysis: RT-PCR and qPCR to confirm absence of Fcer1g mRNA

    • Protein analysis: Western blotting to confirm absence of Fcer1g protein

    • Functional validation: Assessing expected phenotypes, such as altered immune responses

The validated Fcer1g knockout model can then be used for studying Fcer1g function in various physiological and pathological contexts.

What are the implications of Fcer1g expression in neurological disease models, particularly gliomas?

Fcer1g has significant implications in neurological disease models, with particular relevance to gliomas:

Understanding these implications can help researchers design more targeted studies to explore the role of Fcer1g in glioma progression and potential therapeutic interventions.

How can lentiviral systems be optimized for efficient expression of recombinant rat Fcer1g?

Optimizing lentiviral systems for efficient expression of recombinant rat Fcer1g involves several critical considerations:

  • Vector Selection and Design:

    • Use appropriate lentiviral vectors like VVPW that allow for high-level expression

    • Include appropriate promoters (CMV or EF1α for strong expression)

    • Consider adding tags (such as FLAG) for easier detection and purification

    • Optimize codon usage for rat systems if necessary

  • Cloning Strategy:

    • Design primers with appropriate restriction sites (e.g., KpnI and NotI) for directional cloning

    • Verify the cloned sequence before virus production to ensure no mutations were introduced

  • Transfection Optimization:

    • Use optimal ratios of transfer vector:packaging plasmid:envelope plasmid (typically 3:2:1)

    • Select appropriate transfection reagents (e.g., FUGENE HD) for high efficiency

    • Ensure 293T cells are at optimal confluence (~70%) during transfection

  • Virus Collection and Concentration:

    • Collect supernatants at optimal time points (typically 48 and 72 hours post-transfection)

    • Consider concentrating virus for higher titers using ultracentrifugation or commercial concentration kits

    • Validate virus quality by qPCR or reporter gene expression

  • Target Cell Transduction:

    • Add polybrene (typically 8 μg/mL) to enhance transduction efficiency

    • Optimize virus concentration for specific target cells

    • Allow sufficient time (72+ hours) for protein expression after transduction

    • Validate expression by qPCR, Western blot, or functional assays

By carefully optimizing each of these parameters, researchers can achieve high-level expression of functional recombinant rat Fcer1g in their experimental systems.

What methodological approaches can be used to study Fcer1g interactions with other signaling molecules in immune cells?

Several sophisticated approaches can be employed to study Fcer1g interactions with other signaling molecules:

  • Co-Immunoprecipitation (Co-IP):

    • Lysates from cells expressing Fcer1g (native or tagged) are incubated with specific antibodies

    • Immuno-complexes are isolated using protein G/A magnetic beads

    • Interacting partners are identified by Western blotting or mass spectrometry

    • FLAG-tagged Fcer1g can be used for cleaner pull-downs with anti-FLAG antibodies

  • Proximity Ligation Assay (PLA):

    • Allows visualization of protein-protein interactions in situ

    • Utilizes antibodies with attached oligonucleotides that generate a signal when in close proximity

    • Provides spatial information about interactions within cells

  • FRET/BRET Analysis:

    • Fusion proteins with fluorescent/bioluminescent tags can reveal real-time interactions

    • Changes in energy transfer indicate proximity/interaction between proteins

    • Allows for studying dynamic interactions in living cells

  • Proteomic Analysis of Fcer1g Vesicles:

    • FLAG-tagged Fcer1g vesicles can be isolated from cell lysates

    • Mass spectrometry analysis of isolated vesicles can identify associated proteins

    • Comparison between wild-type and knockout cells can validate specific interactions

  • Yeast Two-Hybrid or Mammalian Two-Hybrid Screening:

    • Systematic identification of potential interacting partners

    • Validation of interactions in mammalian expression systems

  • BiFC (Bimolecular Fluorescence Complementation):

    • Split fluorescent proteins are fused to potential interacting partners

    • Interaction brings fragments together, restoring fluorescence

    • Allows visualization of interactions in living cells

These methodological approaches provide complementary information about Fcer1g interactions, from identification of binding partners to characterization of the dynamics and localization of these interactions in cellular contexts.

What are the critical factors to consider when designing ELISA assays for rat Fcer1g quantification?

When designing ELISA assays for rat Fcer1g quantification, researchers should consider these critical factors:

  • Assay Format Selection:

    • Sandwich ELISA is preferred for complex biological samples due to its higher specificity and sensitivity (detection range: 0.312-20 ng/ml; sensitivity: <0.15 ng/ml)

    • Direct ELISA may be suitable for purified preparations but has lower specificity

  • Sample Preparation:

    • Tissue homogenates require thorough mechanical disruption followed by gentle lysis to preserve protein integrity

    • Cell lysates should be prepared with appropriate lysis buffers containing protease inhibitors

    • Sample dilutions should target the mid-range of the assay (0.312-20 ng/ml) for optimal accuracy

  • Control Selection:

    • Include both positive controls (known Fcer1g standards) and negative controls (samples from Fcer1g knockout animals if available)

    • Prepare a standard curve using purified recombinant rat Fcer1g covering the full detection range

  • Antibody Validation:

    • Verify antibody specificity against rat Fcer1g using Western blotting

    • Test for cross-reactivity with related proteins, particularly other Fc receptor subunits

  • Assay Optimization:

    • Determine optimal antibody concentrations through titration experiments

    • Optimize incubation times and temperatures for maximum sensitivity and minimal background

    • Test different blocking agents to minimize non-specific binding

  • Data Analysis and Interpretation:

    • Use four-parameter logistic regression for standard curve fitting

    • Account for dilution factors in final concentration calculations

    • Consider the biological relevance of detected concentrations in the context of the experimental model

Addressing these factors systematically will ensure reliable and reproducible quantification of rat Fcer1g in research applications.

How can researchers address potential cross-reactivity issues in Fcer1g functional studies?

Cross-reactivity presents a significant challenge in Fcer1g studies due to structural similarities with other Fc receptor subunits. Researchers can address these issues through several approaches:

  • Antibody Validation Strategy:

    • Test antibody specificity using samples from Fcer1g knockout models as negative controls

    • Perform Western blotting to confirm single-band detection at the expected molecular weight

    • Conduct peptide competition assays to verify epitope specificity

    • Pre-absorb antibodies with related proteins to reduce cross-reactivity

  • Genetic Controls:

    • Include Fcer1g knockout cells/tissues in parallel experiments

    • Use siRNA or shRNA knockdown to create specific Fcer1g-depleted samples for comparison

    • Employ CRISPR/Cas9 genome editing to generate clean knockout models for validation

  • Recombinant Protein Controls:

    • Express tagged versions of Fcer1g (e.g., FLAG-tagged) to distinguish from endogenous proteins

    • Use purified recombinant proteins of related family members to test cross-reactivity

    • Create chimeric proteins to map specific interaction domains

  • Analytical Approaches:

    • Employ mass spectrometry for unambiguous protein identification

    • Use multiple antibodies targeting different epitopes to confirm specificity

    • Validate results using orthogonal detection methods

  • Experimental Design Considerations:

    • Include isotype control antibodies in immunoprecipitation experiments

    • Design experiments with appropriate positive and negative controls

    • Validate key findings using complementary approaches

By implementing these strategies, researchers can minimize cross-reactivity issues and increase confidence in the specificity of their Fcer1g functional studies.

What are the best approaches for studying Fcer1g expression and function in different immune cell populations?

Studying Fcer1g across diverse immune cell populations requires specialized approaches:

  • Cell Isolation and Characterization:

    Cell TypeIsolation MethodMarkers for Verification
    Mast cellsPeritoneal lavage or bone marrow culturec-Kit, FcεRI
    MacrophagesPeritoneal lavage or bone marrow cultureCD11b, F4/80
    NeutrophilsDensity gradient from bone marrowLy6G, CD11b
    Dendritic cellsBone marrow culture with GM-CSF/IL-4CD11c, MHC II
    NK cellsNegative selection from spleenNK1.1, CD49b
  • Expression Analysis:

    • Flow cytometry: Surface and intracellular staining for Fcer1g protein

    • qRT-PCR: Transcript quantification from sorted cell populations

    • Single-cell RNA-seq: Comprehensive expression profiling across heterogeneous populations

    • Immunohistochemistry: Spatial distribution in tissues with cell-type specific markers

  • Functional Assays:

    • Degranulation assays (β-hexosaminidase release) for mast cells

    • Phagocytosis assays for macrophages and neutrophils

    • Cytokine production measurement by ELISA or intracellular cytokine staining

    • Calcium flux assays to evaluate Fcer1g-dependent signaling

    • Antibody-dependent cellular cytotoxicity (ADCC) assays for NK cells

    • Migration and chemotaxis assays to assess cellular responses

  • Genetic Manipulation Approaches:

    • Cell-type specific Cre-loxP conditional knockout models

    • Adoptive transfer of Fcer1g-deficient cells into wild-type recipients

    • Retroviral/lentiviral reconstitution of knockout cells with wild-type or mutant Fcer1g

    • CRISPR/Cas9-mediated editing in primary immune cells or cell lines

  • Systems Biology Approaches:

    • Phospho-proteomics to map Fcer1g-dependent signaling networks

    • ChIP-seq to identify transcriptional changes downstream of Fcer1g activation

    • Interactome analysis to identify cell-type specific binding partners

These approaches enable comprehensive characterization of Fcer1g functions across various immune cell populations, revealing cell-type specific roles in immune responses.

How can researchers interpret conflicting results between in vitro and in vivo Fcer1g functional studies?

Interpreting discrepancies between in vitro and in vivo Fcer1g studies requires systematic analysis:

  • Contextual Differences Assessment:

    • Microenvironmental factors: In vivo systems contain complex cytokine networks, extracellular matrix components, and cell-cell interactions absent in vitro

    • Compensatory mechanisms: Redundant pathways may mask Fcer1g deficiency effects in vivo but not in simplified in vitro systems

    • Temporal considerations: Acute responses in vitro may differ from chronic adaptations in vivo

  • Methodological Evaluation:

    • Model system relevance: Cell lines may lack key regulatory components present in primary cells

    • Knockout validation: Confirm complete protein absence in both systems using sensitive detection methods

    • Dose-response relationships: In vitro studies often use non-physiological concentrations of stimuli

  • Reconciliation Strategies:

    • Ex vivo studies: Isolate cells from in vivo models for immediate functional testing

    • Organoid/3D culture systems: Bridge the gap between traditional 2D culture and in vivo complexity

    • Adoptive transfer: Test in vitro manipulated cells in in vivo settings

    • Tissue-specific conditional knockouts: Target Fcer1g deletion to specific cell types or tissues

  • Systems Biology Approach:

    • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data

    • Network analysis: Identify context-dependent interactions and regulatory mechanisms

    • Mathematical modeling: Develop predictive models that account for system complexity

  • Translational Considerations:

    • Human tissue validation: Verify key findings in relevant human samples when possible

    • Cross-species comparisons: Systematically evaluate conservation of Fcer1g functions

    • Therapeutic implications: Focus on consistent findings with potential clinical relevance

By applying these analytical frameworks, researchers can develop more nuanced interpretations of seemingly conflicting results, potentially revealing context-dependent functions of Fcer1g that enhance our understanding of its biological roles.

What is the significance of Fcer1g expression in cancer progression and potential therapeutic targeting?

Fcer1g has emerged as a significant factor in cancer biology with important implications for therapeutic development:

The significant upregulation of Fcer1g in malignancies such as diffuse large B-cell lymphoma (DLBCL), as demonstrated by gene expression profiling, further supports its role in cancer progression and potential as a therapeutic target .

How can Fcer1g knockout animal models be utilized to understand its role in autoimmune and inflammatory diseases?

Fcer1g knockout models provide valuable insights into autoimmune and inflammatory diseases:

  • Model Development and Validation:

    • Fcer1g knockout mice were originally developed in the laboratory of J.V. Ravetch in 1993 by targeting the Fcer1g gene in E14 ES cells

    • Backcrossing to specific genetic backgrounds (e.g., BALB/c) enables study of strain-specific effects

    • Validation includes confirmation of gene targeting, absence of protein expression, and characterization of immune cell phenotypes

  • Applications in Autoimmune Disease Models:

    Disease ModelMethodologyKey Findings/Applications
    Rheumatoid arthritisCollagen-induced arthritis in Fcer1g-/- miceAssess role in joint inflammation and cartilage destruction
    Systemic lupus erythematosusPristane-induced lupus in Fcer1g-/- miceEvaluate contributions to autoantibody production and tissue damage
    Multiple sclerosisExperimental autoimmune encephalomyelitis in Fcer1g-/- miceStudy neuroinflammation and demyelination processes
    Inflammatory bowel diseaseDSS-induced colitis in Fcer1g-/- miceInvestigate intestinal inflammation and barrier function
  • Mechanistic Investigations:

    • Cell-specific effects: Analysis of mast cells, macrophages, neutrophils, and other immune populations in Fcer1g-/- animals

    • Signaling pathway analysis: Identification of Fcer1g-dependent inflammatory mediators

    • Compensatory mechanisms: Assessment of alternative pathways activated in Fcer1g deficiency

    • Temporal dynamics: Evaluation of acute versus chronic inflammatory responses

  • Translational Applications:

    • Therapeutic target validation: Determination if Fcer1g inhibition ameliorates disease parameters

    • Biomarker development: Correlation of Fcer1g expression with disease activity

    • Drug screening: Use of Fcer1g-/- cells to identify compounds that mimic genetic deletion

    • Safety assessment: Evaluation of potential adverse effects of Fcer1g targeting

  • Advanced Model Approaches:

    • Conditional knockout systems: Temporal or cell-type specific deletion of Fcer1g

    • Humanized models: Introduction of human Fcer1g variants to study polymorphism effects

    • Reporter systems: Integration of fluorescent reporters to track Fcer1g expression in vivo

These models facilitate comprehensive understanding of Fcer1g's multifaceted roles in autoimmune and inflammatory conditions, potentially leading to novel therapeutic strategies.

What are the common technical challenges in recombinant rat Fcer1g expression and purification?

Researchers face several technical challenges when working with recombinant rat Fcer1g:

  • Expression Challenges:

    • Low expression levels due to toxicity or protein instability

    • Improper folding leading to inclusion body formation

    • Post-translational modification differences between expression systems and native protein

    Solutions:

    • Optimize codon usage for the expression host

    • Use inducible expression systems with tight regulation

    • Test multiple tags (His, FLAG, GST) to identify optimal fusion partner

    • Employ specialized host strains designed for membrane-associated proteins

    • Consider lentiviral expression systems for mammalian expression

  • Solubility Issues:

    • Fcer1g contains hydrophobic regions that may cause aggregation

    • Interaction with host cell membranes may complicate extraction

    Solutions:

    • Test various detergents (CHAPS, DDM, Triton X-100) for optimal solubilization

    • Use fusion partners known to enhance solubility (MBP, SUMO)

    • Optimize buffer compositions with stabilizing agents

    • Consider native-like nanodiscs or liposomes for membrane protein purification

  • Purification Challenges:

    • Non-specific binding to purification resins

    • Co-purification of interacting host proteins

    • Protein degradation during purification

    Solutions:

    • Employ multi-step purification strategies (affinity, ion exchange, size exclusion)

    • Include protease inhibitors throughout purification

    • Perform purification at 4°C to minimize degradation

    • Consider on-column refolding for proteins recovered from inclusion bodies

    • Use FLAG-tag immunoprecipitation for improved specificity

  • Activity and Stability Issues:

    • Loss of functional activity during purification

    • Limited shelf-life of purified protein

    Solutions:

    • Validate functionality using binding assays or cell-based reporter systems

    • Optimize storage conditions (buffer composition, pH, additives)

    • Consider lyophilization for long-term storage

    • Test cryoprotectants for frozen storage

Addressing these challenges requires systematic optimization and may necessitate different approaches depending on the specific application requirements for the recombinant protein.

How can researchers optimize antibody selection and validation for Fcer1g research?

Optimizing antibody selection and validation is critical for reliable Fcer1g research:

  • Systematic Antibody Selection Criteria:

    • Epitope location: Choose antibodies targeting conserved regions for cross-species studies or unique regions for specificity

    • Host species: Select antibodies raised in species distant from the target to maximize immunogenicity

    • Clone type: Consider monoclonal for high specificity or polyclonal for robust detection

    • Application compatibility: Verify suitability for intended applications (WB, IP, IHC, Flow)

    • Validation status: Prioritize antibodies with published validation in multiple assays

  • Comprehensive Validation Protocol:

    • Positive controls: Test on recombinant Fcer1g or overexpression systems

    • Negative controls: Validate using Fcer1g knockout tissues/cells

    • Peptide competition: Confirm specificity by pre-absorption with immunizing peptide

    • Cross-reactivity assessment: Test on related proteins (other Fc receptor subunits)

    • Reproducibility testing: Verify consistent results across different lots

  • Application-Specific Validation:

    • Western blotting: Confirm single band at expected molecular weight (~9-10 kDa)

    • Immunoprecipitation: Verify pull-down of known interaction partners

    • Immunohistochemistry: Compare staining pattern with mRNA expression

    • Flow cytometry: Correlate with cell types known to express Fcer1g

    • ELISA: Establish standard curves with recombinant protein

  • Advanced Validation Approaches:

    • CRISPR knockout validation: Generate CRISPR/Cas9 Fcer1g knockout cells for definitive negative controls

    • Orthogonal validation: Compare results from antibodies targeting different epitopes

    • Mass spectrometry confirmation: Verify immunoprecipitated proteins by MS analysis

    • Functional validation: Assess antibody effects on known Fcer1g-dependent functions

  • Documentation and Reporting Standards:

    • Record detailed validation data for each antibody and application

    • Document key parameters (catalog number, lot, dilution, incubation conditions)

    • Share validation data through repositories like Antibodypedia or publications

    • Update validation periodically, especially with new antibody lots

Implementing these rigorous validation practices ensures reliable research outcomes and facilitates reproducibility across different laboratories studying Fcer1g.

What emerging technologies hold promise for advancing Fcer1g research?

Several cutting-edge technologies are poised to revolutionize Fcer1g research:

  • CRISPR/Cas-Based Approaches:

    • Base editing and prime editing for precise modification of Fcer1g without double-strand breaks

    • CRISPR activation/inhibition (CRISPRa/CRISPRi) for temporal control of Fcer1g expression

    • CRISPR screens to identify novel Fcer1g interaction partners or regulatory factors

    • In vivo CRISPR delivery for tissue-specific Fcer1g manipulation

  • Advanced Imaging Technologies:

    • Super-resolution microscopy for visualizing Fcer1g localization at nanoscale resolution

    • Live-cell imaging with fluorescent-tagged Fcer1g to track dynamics in real-time

    • Intravital microscopy to observe Fcer1g-mediated immune interactions in living animals

    • Correlative light and electron microscopy (CLEM) to connect Fcer1g function with ultrastructural context

  • Single-Cell Technologies:

    • Single-cell RNA-seq to profile Fcer1g expression heterogeneity across immune populations

    • Single-cell proteomics to quantify Fcer1g protein levels and modifications

    • Single-cell ATAC-seq to identify regulatory elements controlling Fcer1g expression

    • Spatial transcriptomics to map Fcer1g expression in tissue context

  • Protein Engineering and Structural Biology:

    • AlphaFold2 and other AI-based structural prediction of Fcer1g interactions

    • Cryo-EM analysis of Fcer1g-containing receptor complexes

    • Proximity labeling (BioID, APEX) to map the Fcer1g interactome in living cells

    • Optogenetic and chemogenetic tools for precise temporal control of Fcer1g signaling

  • Organoid and Microphysiological Systems:

    • Immune organoids incorporating Fcer1g-expressing cells for disease modeling

    • Organ-on-chip technologies to study Fcer1g in tissue-specific contexts

    • Patient-derived systems to evaluate Fcer1g function in personalized disease models

These emerging technologies will enable unprecedented insights into Fcer1g biology, from molecular mechanisms to systemic functions in health and disease.

What are the potential applications of Fcer1g research in precision medicine approaches?

Fcer1g research has several promising applications in precision medicine:

  • Biomarker Development:

    • Prognostic biomarkers: High Fcer1g expression is associated with poor prognosis in gliomas (HR:0.31, 95% CI 0.23–0.41) and other cancers, enabling risk stratification

    • Predictive biomarkers: Fcer1g expression patterns may predict response to immunotherapies

    • Monitoring biomarkers: Tracking Fcer1g levels or activity to assess disease progression

    • Early detection: Incorporation into multi-marker panels for cancer screening

  • Therapeutic Target Identification:

    • Direct targeting: Development of small molecules or antibodies against Fcer1g

    • Pathway modulation: Identification of druggable nodes in Fcer1g signaling networks

    • Combination approaches: Rational design of combination therapies targeting Fcer1g and complementary pathways

    • Resistance mechanisms: Understanding how Fcer1g contributes to treatment resistance

  • Patient Stratification Strategies:

    • Molecular subtypes: Classification of patients based on Fcer1g expression patterns

    • Treatment algorithms: Development of decision trees incorporating Fcer1g status

    • Risk assessment: Integration of Fcer1g into prognostic indices

    • Clinical trial design: Enrichment strategies for selecting patients likely to respond to Fcer1g-targeted therapies

  • Novel Therapeutic Approaches:

    • Gene therapy: Correction of Fcer1g dysregulation in specific diseases

    • Cell-based therapies: Engineering immune cells with modified Fcer1g signaling

    • RNA therapeutics: siRNA or antisense oligonucleotides targeting Fcer1g

    • Targeted delivery: Nanoparticle-based delivery of Fcer1g modulators to specific tissues

  • Immune Monitoring:

    • Assessing immune activation status through Fcer1g expression profiles

    • Predicting immune-related adverse events in cancer immunotherapy

    • Monitoring therapeutic response to immune-modulating drugs

    • Personalized vaccine responses based on Fcer1g pathway activity

These applications highlight the potential of translating basic Fcer1g research into clinically relevant tools for precision medicine, particularly in oncology and immunology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.