Recombinant Rat Histamine H2 receptor (Hrh2)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characterization

The rat H2R shares structural and functional homology with its human counterpart, consisting of 359 amino acids with seven transmembrane domains . Key features include:

  • Gene location: Chromosome 5 in rats .

  • Signaling pathways:

    • Primary: Activation of adenylate cyclase via Gs proteins, increasing cAMP levels .

    • Secondary: Phosphoinositide/protein kinase C (PKC) pathway via Gq proteins .

Research Tools and Reagents

Recombinant Hrh2 is utilized in assays to study receptor-ligand interactions, signaling mechanisms, and drug discovery. Commercial kits and antibodies include:

ELISA Kits for Rat Hrh2 Quantification

ParameterSpecification (Abbexa Ltd)Reference
ReactivityRat
Detection Range0.156–10 ng/ml
Sample TypesTissue homogenates, cell lysates
Detection MethodColorimetric (sandwich ELISA)

Antibodies for Immunodetection

Product Code (CUSABIO)ApplicationsSpecies Reactivity
CSB-PA010738GA01HUELISA, WBHuman, Mouse, Rat
CSB-PA009281WB, IF, ELISAHuman

Gastrointestinal and Immune Modulation

  • Gastric acid secretion: Recombinant Hrh2 is essential for studying histamine-induced acid secretion in parietal cells .

  • Immune regulation: H2R blockade (e.g., ranitidine) reduces B-cell counts and IL-2Rα+ T cells in humans, highlighting its immunomodulatory role .

Neurological Applications

  • Oligodendrocyte differentiation:

    • Genetic deletion of Hrh2 in mice (Hrh2 fl/fl;CNPase-Cre) enhances oligodendrocyte differentiation and remyelination post-hypoxic injury .

    • H2R antagonists (e.g., cimetidine) promote myelin repair by inhibiting Wnt/β-catenin signaling .

Cardiovascular Effects

  • Cardiac contractility:

    • Agonists like dimaprit and apromidine derivatives increase inotropic effects in guinea pig hearts via H2R activation .

    • H2R overexpression in endothelial cells modulates vascular responses .

Applications in Disease Models

Disease ModelRole of Hrh2Therapeutic Implications
Neonatal hypoxic-ischemic encephalopathyInhibits oligodendrocyte differentiationH2R antagonists improve remyelination
Gastroesophageal reflux disease (GERD)Mediates acid secretionH2R blockers (ranitidine) reduce gastric acidity
Breast cancer metastasisRegulates myeloid-derived suppressor cellsRanitidine suppresses tumor progression in murine models

Technical Considerations for Recombinant Hrh2

  • Expression systems: Typically expressed in mammalian cell lines (e.g., HEK293) for proper post-translational modifications .

  • Validation: Western blot (WB) and immunofluorescence (IF) confirm receptor integrity .

Challenges and Future Directions

  • Species specificity: Rat Hrh2 shares ~85% amino acid identity with human H2R, necessitating cross-validation in translational studies .

  • Dual signaling: The receptor’s coupling to both cAMP and PKC pathways complicates mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific requirement for the format, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Hrh2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEPNGTVHSCCLDSMALKVTISVVLTTLILITIAGNVVVCLAVSLNRRLRSLTNCFIVSL AATDLLLGLLVLPFSAIYQLSFTWSFGHVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV YGLVDGLVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG AFIICWFPYFTAFVYRGLRGDDAINEAVEGIVLWLGYANSALNPILYAALNRDFRTAYQQ LFHCKFASHNSHKTSLRLNNSLLPRSQSREGRWQEEKPLKLQVWSGTELTHPQGNPIR
Uniprot No.

Target Background

Function
Histamine H2 receptors, belonging to the H2 subclass, play a critical role in mediating gastric acid secretion. The receptor's activity is modulated by G proteins, which activate adenylyl cyclase.
Gene References Into Functions
  1. Histaminergic afferent inputs in the striatum may modulate both dopamine D1 and D2 receptor-expressing medium spiny projection neurons through the activation of postsynaptic histamine H1 and H2 receptors. PMID: 29498008
  2. Research indicates that histamine H1, H2, and H3 receptors are present in rat olfactory epithelium and may contribute to olfactory transmission. PMID: 28964277
  3. In isolated rat mesenteric collecting lymphatics, treatment with 1- to 100-muM histamine was investigated. Blocking either H1 or H2 histamine receptors significantly inhibited the response to histamine. PMID: 24702851
  4. Na+-Ca2+ exchangers coupled to H1 receptors and hyperpolarization-activated cyclic nucleotide-gated channels linked to H2 receptors collaboratively mediate the robust postsynaptic excitatory action of histamine on al vestibular nucleus neurons. PMID: 23713466
  5. Unlike the H1 receptor type, histamine H2 receptors do not mediate impairment of emotional memory consolidation. PMID: 22986235
  6. Data suggests that histamine stimulates proliferation of Leydig tumor cells via activation of HRH2 and a transient increase in intracellular cAMP levels. Normal/immature Leydig cells and progenitor Leydig cells exhibit very low levels of HDC expression. PMID: 23077168
  7. Studies indicate that histamine facilitates the consolidation of fear extinction through a mechanism involving Hrh2-dependent phosphorylation of ERK1 in the hippocampus. PMID: 21211106
  8. At the level of the hippocampus, histamine, acting through its H1 and H2 receptors, mediates pain in the orofacial region. PMID: 21602597
  9. H1, H2, and H3 histamine receptor mRNA was detected in the modiolus but not in the lateral and medial portions of the cochlea. This provides the first evidence of H1, H2, and H3 histamine receptor mRNA in the rat cochlea. PMID: 12634496
  10. A postischemic decrease in H(2) receptor binding densities was observed in the caudate-putamen. PMID: 16181737
  11. Endogenous histamine may be involved in the recruitment of neutrophils and protein leaks in LPS-induced acute lung injury via the H2 receptors. PMID: 16858644
  12. Research demonstrates that famotidine, a H2 receptor antagonist, decreases the late phase of orthodontic tooth movement in rats. PMID: 18345502

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of the rat histamine H2 receptor?

The rat histamine H2 receptor consists of 359 amino acids and belongs to the rhodopsin-like receptor family (class A), which represents the largest and best-studied group of G protein-coupled receptors (GPCRs) . The receptor is encoded by a gene located on chromosome 5 and shares significant homology with the human H2 receptor . The receptor contains seven transmembrane domains characteristic of GPCRs, with an extracellular N-terminus and an intracellular C-terminus that couples to G proteins, primarily Gs, which activates adenylyl cyclase and increases intracellular cAMP levels.

How does the rat H2 receptor differ from other histamine receptor subtypes?

The rat H2 receptor differs from other histamine receptor subtypes (H1, H3, and H4) in several key aspects:

  • Signal transduction: While H1R couples primarily to Gq/11 proteins, H2R couples to Gs proteins, and H3R and H4R couple to Gi/o proteins .

  • Affinity for histamine: H2R has lower affinity for histamine compared to H1, H3, and H4 receptors .

  • Tissue distribution: H2R is predominantly expressed in gastric parietal cells, cardiac tissue, and certain regions of the brain, whereas other receptors have different distribution patterns .

  • Pharmacological profile: H2R responds to specific agonists and antagonists that have limited or no activity at other histamine receptor subtypes .

What are the standard methods for expressing recombinant rat H2 receptors?

Recombinant rat H2 receptors are typically expressed in mammalian cell lines such as HEK-293T cells through transient or stable transfection methods . The procedure generally involves:

  • Cloning the rat H2 receptor cDNA into an appropriate expression vector containing a strong promoter (e.g., CMV) and a selection marker.

  • Transfecting the construct into host cells using methods such as calcium phosphate precipitation, lipofection, or electroporation.

  • For stable expression, selecting transfected cells using appropriate antibiotics and isolating clones with high receptor expression.

  • Verifying receptor expression through binding assays with radiolabeled ligands such as [³H]-Nα-methylhistamine or [³H]UR-KAT479 .

What are the key physiological functions of the H2 receptor in rats?

The H2 receptor mediates several important physiological functions in rats:

  • Regulation of gastric acid secretion in the stomach by stimulating parietal cells .

  • Modulation of cardiac function, including positive chronotropic and inotropic effects, although these effects are species-dependent (notably, adult mouse cardiomyocytes do not express functional H2R) .

  • Involvement in immune regulation, particularly in T cell responses .

  • Potential roles in central nervous system functions, including cognition and behavior, although these functions remain less characterized .

What are the current approaches for studying H2 receptor-ligand interactions?

Modern approaches for studying H2 receptor-ligand interactions include:

  • Radioligand binding assays: These remain the gold standard and utilize tritium or carbon-14 labeled ligands. For example, [³H]UR-KAT479 represents a G protein-biased radioligand that has advanced our understanding of H2R function in the CNS . Saturation binding assays with [³H]-Nα-MH yield important parameters such as KD and Bmax values for receptor characterization .

  • BRET-based binding assays: Bioluminescence Resonance Energy Transfer (BRET) assays provide a fluorescence-based alternative to radioligand binding. A homogeneous live cell-based BRET binding assay using fluorescently labeled squaramide-type compounds, such as the Py-1-labeled ligand UR-KAT478, has been established . This assay allows for:

    • Real-time kinetic experiments showing full association within approximately 30 minutes

    • Observation of slow dissociation kinetics

    • Competition binding studies that yield pKi values comparable to radioligand binding data

  • Computational approaches: Molecular docking and molecular dynamics simulations based on homology models of the rat H2 receptor provide insights into the structural basis of ligand binding and receptor activation.

How can receptor subtype selectivity be achieved in H2 receptor research?

Achieving receptor subtype selectivity in H2 receptor research requires careful consideration of:

  • Pharmacological tools: While histamine activates all four histamine receptor subtypes (with lowest affinity for H2R), compounds like dimaprit were initially thought to be H2R-selective but later found to also stimulate H3 and H4 receptors . Compound 16 is currently recognized as one of the most potent and selective H2R agonists .

  • Experimental design considerations:

    • Use of selective antagonists as controls (e.g., cimetidine, ranitidine, or famotidine for H2R)

    • Inclusion of receptor knockout controls where available

    • Cross-validation with multiple selective ligands

    • Expression systems with defined receptor populations

  • Genetic approaches: Utilizing H2R knockout mice, floxed H2R mice for tissue-specific deletion, or mice with cardiac-specific overexpression of H2R .

What are the challenges in developing biased ligands for the rat H2 receptor?

Developing biased ligands for the rat H2 receptor faces several challenges:

  • Pathway selectivity: The H2 receptor couples to multiple signaling pathways beyond the canonical Gs-adenylyl cyclase-cAMP pathway, including β-arrestin recruitment and potentially Gq coupling . Designing ligands that selectively activate or inhibit specific pathways requires in-depth understanding of structure-activity relationships.

  • Species differences: Significant pharmacological differences exist between rat and human H2 receptors, complicating the translation of findings from rat models to human applications.

  • Assay development: Establishing reliable assays for multiple signaling pathways that can be used in parallel to characterize bias profiles presents technical challenges.

  • Structure-based design limitations: The lack of a high-resolution crystal structure of the rat H2 receptor hinders rational design of biased ligands.

How are radioligand binding assays optimized for the rat H2 receptor?

Optimization of radioligand binding assays for the rat H2 receptor includes:

  • Membrane preparation: Cell membranes expressing rH2R are carefully prepared to maintain receptor integrity and functionality.

  • Saturation binding protocol:

    • Incubation of membranes with increasing concentrations of radioligand (e.g., [³H]-Nα-MH at 0-20 nM)

    • Parallel incubations with unlabeled competitor (e.g., thioperamide at 10 μM) to determine non-specific binding

    • Incubation conditions: 2 hours at 25°C

    • Termination by rapid filtration on GF/C 96-well plates

    • Measurement of bound radioligand by scintillometry

  • Data analysis: Calculation of specific binding as the difference between total and non-specific binding, followed by analysis to determine KD and Bmax values .

For the rat H2 receptor, optimized conditions have yielded KD values of approximately 2.72 ± 0.34 nM and Bmax values of approximately 2715 ± 445 fmol mg⁻¹ protein, which differ from the human H2 receptor (KD: 0.9 ± 0.08 nM; Bmax: 632 ± 52 fmol mg⁻¹ protein) .

What genetic tools are available for studying the H2 receptor in rodent models?

Several genetic tools have been developed for studying the H2 receptor in rodent models:

  • Constitutive knockout mice: These mice have global deletion of the H2R gene and are valuable for understanding the physiological roles of H2R in vivo .

  • Floxed H2R mice: These mice contain loxP sites flanking the H2R gene, allowing for tissue-specific deletion when crossed with appropriate Cre-expressing lines. This approach has been used to delete H2R specifically in endothelial cells .

  • Transgenic overexpression models: Mouse lines with cardiac-specific overexpression of H2R provide insights into the role of H2R in cardiac function .

  • Cell-specific deletion: The floxed H2R model can potentially be used to generate cell-specific removal or reduced expression of H2R in various tissues, although this approach may not be informative for adult mouse cardiomyocytes, which do not express functional H2R .

How can BRET-based binding assays be implemented for H2 receptor studies?

Implementation of BRET-based binding assays for H2 receptor studies involves:

  • Assay development:

    • Generation of NanoLuc-tagged H2 receptor constructs

    • Synthesis of fluorescently labeled ligands (e.g., squaramide-type compounds)

    • Optimization of expression systems and assay conditions

  • Experimental protocol:

    • Expression of NanoLuc-tagged H2 receptors in live cells

    • Addition of fluorescently labeled ligands (e.g., Py-1-labeled ligand UR-KAT478)

    • Measurement of BRET signals using appropriate instrumentation

  • Assay applications:

    • Saturation binding experiments to determine affinity (pKd values)

    • Real-time kinetic measurements of association and dissociation

    • Competition binding studies with reference compounds

The BRET-based binding assay offers advantages over traditional radioligand binding, including real-time monitoring, reduced hazards associated with radioactivity, and compatibility with live cell systems .

How do you address species differences when extrapolating rat H2 receptor data to humans?

Addressing species differences requires several considerations:

  • Comparative pharmacology approach:

    • Parallel testing of ligands in both rat and human receptor systems

    • Establishment of correlation factors for potency and efficacy

    • Identification of species-specific pharmacophores

  • Structural analysis:

    • Sequence alignment and homology modeling to identify key differences in binding sites

    • Site-directed mutagenesis to confirm the role of specific amino acid differences

  • Signaling pathway comparison:

    • Evaluation of coupling efficiency to various G proteins and β-arrestins

    • Assessment of differences in signal transduction cascades

  • Translation considerations:

    • Use of allometric scaling for pharmacokinetic parameters

    • Development of species-specific correction factors for pharmacodynamic effects

    • Consideration of differential tissue distribution and expression levels

What are the technical limitations in studying H2 receptor signaling bias?

Studying H2 receptor signaling bias faces several technical limitations:

How do you resolve conflicting binding data from different experimental approaches?

Resolving conflicting binding data requires systematic investigation:

  • Methodological comparison:

    • Side-by-side comparison of radioligand and BRET-based binding assays

    • Evaluation of buffer conditions, temperature, and incubation times

    • Assessment of membrane preparation methods versus intact cell assays

  • Statistical approaches:

    • Meta-analysis of multiple datasets

    • Weighted averaging based on experimental precision

    • Bayesian methods to incorporate prior knowledge

  • Validation strategies:

    • Orthogonal assays to confirm binding interactions

    • Functional correlation to link binding to downstream signaling

    • Structural biology approaches where feasible

How have advances in structural biology impacted H2 receptor research?

Recent advances in structural biology have significantly impacted H2 receptor research:

  • Homology modeling: While no crystal structure of the H2 receptor is currently available, high-resolution structures of related aminergic GPCRs have enabled increasingly accurate homology models.

  • Cryo-EM approaches: The revolution in cryo-electron microscopy has facilitated the structural determination of GPCRs in complex with various signaling partners, providing insights into conformational changes associated with different signaling states.

  • Computational methods: Enhanced molecular dynamics simulations and free energy calculations have improved our ability to predict ligand binding modes and receptor activation mechanisms.

  • Structure-based drug design: These advances have facilitated rational design of novel H2 receptor ligands with improved selectivity and potentially pathway-biased properties.

What is the current understanding of H2 receptor role in the central nervous system?

Our understanding of H2 receptor function in the CNS remains limited but is advancing:

  • CNS distribution: H2 receptors are expressed in various brain regions, but their precise cellular and subcellular localization remains incompletely characterized.

  • Functional roles: Emerging evidence suggests H2 receptor involvement in:

    • Learning and memory processes

    • Regulation of neurotransmitter release

    • Neuroinflammatory responses

    • Potential roles in neuropsychiatric disorders

  • Tool compounds: The development of CNS-penetrating H2R ligands, especially agonists, is ongoing to better understand the receptor's role in the brain .

  • Future directions: The recent development of the G protein-biased radioligand [³H]UR-KAT479 represents a significant step forward in elucidating the role of H2R in the CNS .

What emerging technologies are transforming H2 receptor research?

Several emerging technologies are reshaping H2 receptor research:

  • CRISPR/Cas9 genome editing: Enabling precise modifications of the H2 receptor gene in various model systems, including the generation of reporter knock-ins and specific mutations.

  • Advanced imaging techniques:

    • Single-molecule microscopy for tracking receptor dynamics

    • FRET/BRET biosensors for real-time monitoring of receptor conformational changes

    • Super-resolution microscopy for visualizing receptor organization in cellular microdomains

  • Chemogenetic approaches: Designer Receptors Exclusively Activated by Designer Drugs (DREADDs) based on the H2 receptor scaffold provide tools for selective manipulation of H2 receptor signaling in specific cell populations.

  • Artificial intelligence and machine learning: These computational approaches are accelerating ligand discovery and optimization, as well as improving prediction of structure-activity relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.