Recombinant Rat Histamine H3 receptor (Hrh3)

Shipped with Ice Packs
In Stock

Description

Pharmacological Profile and Ligand Interactions

Recombinant rat HRH3 exhibits distinct pharmacological properties compared to human HRH3, particularly in ligand binding and inverse agonism. Below is a comparative analysis:

ParameterRat HRH3Human HRH3References
Thioperamide affinity~10× higher potencyLower potency
Ciproxifan affinity~10× higher potencyLower potency
FUB 349 affinityLower potency~10× higher potency
Inverse agonism (Pitolisant)EC₅₀ = 17 nM (Ki)EC₅₀ = 1.5 nM (Ki = 0.3–1.0 nM)
Constitutive activityDetected in native brainDetected in transfected cells

Key findings:

  • Species-specific ligand discrimination: Rat HRH3 shows higher affinity for thioperamide and ciproxifan but lower affinity for FUB 349 compared to human HRH3. This is attributed to amino acid differences in transmembrane domain 3 (e.g., A119T and V122A substitutions) .

  • Inverse agonism: Pitolisant, a non-imidazole H3R antagonist, acts as a potent inverse agonist at rat HRH3 (EC₅₀ = 17 nM) but exhibits higher efficacy at human HRH3 .

Functional Roles and Physiological Significance

Recombinant rat HRH3 is used to study its roles as:

  • Presynaptic autoreceptor: Inhibits histamine release in histaminergic neurons .

  • Heteroreceptor: Modulates release of dopamine, serotonin, GABA, and acetylcholine .

  • Constitutive activity: Exhibits spontaneous signaling in the absence of agonists, reversed by inverse agonists .

4.1. Drug Development

Recombinant rat HRH3 is critical for screening H3R antagonists/inverse agonists, such as:

  • Pitolisant: Approved for narcolepsy; its efficacy in rats correlates with inverse agonism at HRH3 .

  • Thioperamide: A selective H3R antagonist used to enhance histamine turnover in preclinical models .

4.2. Isoform Analysis

Recombinant systems have identified rat HRH3 isoforms generated by alternative splicing:

  • rH3R-445: Canonical full-length isoform .

  • rH3R-413: Deletion in intracellular loop 3 (ΔR274-S305) .

  • rH3R-397: Further truncation in intracellular loop 3 .

Functional implications:

  • rH3R-413: Reduced coupling to G proteins compared to rH3R-445 .

  • rH3R-397: Predominant in hippocampal and hypothalamic regions, linked to cognition and arousal .

5.1. Expression Systems

Recombinant rat HRH3 is typically expressed in E. coli or mammalian cell lines (e.g., HEK293) . Key parameters:

ParameterValueSource
Expression hostE. coli
TagN-terminal 10xHis-tag
Purification methodNickel-based affinity chromatography
Storage-20°C/-80°C (lyophilized)

5.2. Functional Assays

  • Radioligand binding: Uses [³H]-α-methylhistamine or [¹²⁵I]-iodophenpropit .

  • cAMP inhibition: Measures Gi-mediated suppression of adenylate cyclase .

Challenges and Future Directions

  • Isoform-specific tools: Limited availability of isoform-specific antibodies for rat HRH3 .

  • Species translation: Rat HRH3’s pharmacological profile differs from human, complicating drug development .

  • Constitutive activity: Requires careful assay optimization to distinguish agonist/antagonist effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for precise delivery timelines.
Note: Our standard shipping method includes blue ice packs. If dry ice is preferred, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
Hrh3; Histamine H3 receptor; H3R; HH3R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR RAFTKLLCPQKLKVQPHGSLEQCWK
Uniprot No.

Target Background

Function
The H3 subclass of histamine receptors plays a crucial role in mediating histamine signals within the central nervous system (CNS) and peripheral nervous system. Signaling occurs through the inhibition of adenylate cyclase, exhibiting high constitutive activity (spontaneous activity in the absence of an agonist).
Gene References Into Functions
  1. This research indicates the presence of histamine H1, H2, and H3 receptors in the olfactory epithelium of rats, suggesting a physiological role in olfactory transmission. PMID: 28964277
  2. These findings reveal that H3 receptors in the rat nucleus accumbens do not modulate dopamine uptake or release but regulate dopamine synthesis by inhibiting cAMP formation and subsequently PKA activation. PMID: 26169221
  3. These data support the notion that H3 receptors may also mediate non-neuronal histamine effects, suggesting their involvement in fluid homeostasis. PMID: 25745947
  4. The presence of H3 and H4 receptors in endothelial cells suggests their potential significance in regulating blood-brain barrier permeability, including the trafficking of immunocompetent cells. PMID: 23488566
  5. This study confirmed the ability of cultured astrocytes from different rat brain regions to express histamine H3 receptors. PMID: 24432407
  6. These results indicate that co-stimulation of post-synaptic D1 and H3 receptors may indirectly regulate basal dopamine release in the rat striatum. This provides in vivo evidence for a functional interaction between D1 and H3 receptors in the basal ganglia. PMID: 23896530
  7. ZEL-H16 is a novel and potent nonimidazole agonist of H3R, which could potentially serve as a pharmacological tool for future research or as a therapeutic agent targeting H3R. PMID: 22870296
  8. This study demonstrates that short, but not long, isoforms fulfill the function of autoreceptor, supporting the hypothesis that H3 receptor isoforms have distinct functional roles in the brain. PMID: 22356432
  9. Histamine released from degranulated unstainable mast cells induces a transient increase in presynaptic autoinhibitory HRH3 immunoreactivity and mRNA expression as a mechanism to counteract histamine neurotoxicity. PMID: 22277566
  10. These data suggest that brain histamine H(3) receptors, particularly those expressed in the prefrontal cortex, play a crucial role in the autoregulation of histamine neurotransmission. PMID: 22050612
  11. This research demonstrates the involvement of histamine H(3) receptors in protecting against gastric lesions in the rat stomach following the administration of concentrated HCl. PMID: 21839070
  12. This study investigates the involvement of histamine H(3) receptors in the neurotransmission of perivascular adrenergic and CGRPergic nerves. PMID: 21272571
  13. D(1)-H(3) receptor heteromers function as processors integrating dopamine- and histamine-related signals involved in controlling the function of striatal neurons in the direct striatal pathway. PMID: 21173143
  14. This research investigated the effects of essential splice signals on intron retention in histamine H3 receptors and identified sequence elements that determine the differences in splicing between rats and mice. PMID: 19446035
  15. Inhibition of depolarization-stimulated histamine synthesis by the histamine H(3) receptor agonist imetit was impaired by preincubation with pertussis toxin. PMID: 15465923
  16. In the rat thalamus, histamine H(1) receptor and isoforms of the H(3) receptor were primarily expressed in the midline and intralaminar areas. PMID: 15899242
  17. This study investigated oligomers of native hrh3 in rat forebrain membranes. PMID: 15928831
  18. H(3) receptor mRNA expression increased in the caudate putamen of postischemic brain but decreased in the globus pallidus and thalamus. Binding was increased in the cortex, caudate-putamen, globus pallidus, and hippocampus. PMID: 16181737
  19. Histaminergic neurons protect the developing hippocampus from KA-induced neuronal damage, with regulation of neuronal survival being at least partly mediated through H3 receptors. PMID: 16436594
  20. These results collectively indicate that agonist binding promotes the down-regulation of striatal H3 receptors, resulting in a significant loss of function. PMID: 16715497
  21. Processing of proprioceptive information at the level of the mesencephalic trigeminal neurons is controlled via histamine H1 and H3 receptors through different postsynaptic mechanisms. PMID: 16797837
  22. H3 receptor density in the cortical tissue of SHR animals increases with age. PMID: 17531160
  23. The objective of this study was to identify the structural requirements for H3 antagonistic activity through quantitative structure-activity relationship (QSAR) studies and receptor modeling/docking techniques. PMID: 17561422
  24. This research describes the influence of (R)-alpha-methylhistamine on the histamine H3 receptor in the rat gastrointestinal tract. PMID: 17806162
  25. H3 receptors play a significant role in the regulation of hippocampal theta oscillation, representing a potential mechanism involved in histamine-induced modulation of higher brain functions, such as attention and learning. PMID: 17940197
  26. These data suggest that [18F]fluoroproxyfan could potentially be useful for non-invasive imaging of histamine H3 receptors in the human brain using positron emission tomography. PMID: 17998102
  27. This study reveals that histamine H3 and H4 receptors are expressed on distinct endocrine cell types in the rat fundic mucosa. PMID: 18345490
  28. H(3)R is mainly localized around submucosal glands and plays a crucial role in the secretion of submucosal glands in the nose. PMID: 18564330
  29. This is the first evidence suggesting that histaminergic neurons are organized into functionally distinct circuits that influence different brain regions and display selective control mechanisms. PMID: 19490084

Show More

Hide All

Database Links

KEGG: rno:85268

UniGene: Rn.7617

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed abundantly in brain, most notably throughout the thalamus, the ventromedial hypothalamus and the caudate nucleus. Isoform 1 is largely predominant in all tissues.

Q&A

What is the molecular structure of the rat histamine H3 receptor?

The rat histamine H3 receptor (rH3R) is a G-protein coupled receptor encoded by a cDNA clone that produces a putative 445-amino acid protein. The receptor shares 93% identity with the human H3 receptor (hH3R) at the amino acid level. Northern blot analysis reveals a major single entity of 2.7-kb in length expressed predominantly in brain tissue . The receptor structure includes seven transmembrane domains (TMs), with key functional regions in the third transmembrane domain containing amino acids that are critical for ligand binding and species-specific pharmacology .

What are the common experimental systems used for studying recombinant rat H3 receptors?

Recombinant rat H3 receptors are commonly studied using transfected cell lines such as SK-N-MC cells, CHO cells, and HEK293 cells. These experimental systems allow researchers to investigate receptor function through:

  • Radioligand binding assays using ligands such as [3H]Nα-methylhistamine (with Kd values of approximately 0.8 nM)

  • Functional assays measuring inhibition of forskolin-stimulated cAMP formation

  • [35S]GTPγS binding assays to assess receptor-mediated G-protein activation

  • [3H]-arachidonic acid release assays to measure downstream signaling

These systems provide controlled environments for characterizing receptor pharmacology, binding properties, and signaling mechanisms.

What are the optimal methods for establishing stable cell lines expressing the recombinant rat H3 receptor?

When establishing stable cell lines expressing the recombinant rat H3 receptor, researchers should consider:

  • Selection of appropriate cell line: SK-N-MC cells and CHO cells have been successfully used for rH3R expression, with each offering different advantages for specific experimental readouts .

  • Transfection method: Typically, standard transfection protocols using lipid-based transfection reagents are effective, but electroporation may provide better results for certain cell types.

  • Expression level control: It's important to create cell lines with physiologically relevant receptor densities. Studies have shown that constitutive activity of H3 receptors is observed at physiological densities (<500 fmol mg-1 protein) .

  • Validation protocols:

    • Binding assays using [3H]Nα-methylhistamine to confirm receptor expression

    • Functional assays such as inhibition of forskolin-stimulated cAMP formation

    • Western blot analysis using specific antibodies against the H3 receptor

  • Stable clone selection: Select and expand clones showing consistent expression levels and functional responses across passages.

What are the recommended binding assay conditions for studying the pharmacology of rat H3 receptors?

The optimal binding assay conditions for rat H3 receptor pharmacology include:

  • Membrane preparation: Prepare membranes from rat brain tissue or recombinant cells expressing rH3R in ice-cold Na/K phosphate buffer .

  • Radioligand: Use 0.5 nM [3H]Nα-methylhistamine as the radioligand .

  • Incubation buffer: Tris-HCl buffer (typically 50 mM, pH 7.4) .

  • Non-specific binding determination: Include 10 μM thioperamide in parallel samples .

  • Assay termination: Stop the reaction by rapid filtration through Whatman GF/C filters followed by washing with ice-cold buffer .

  • Detection: Measure radioactive signals using a β-counter in the presence of scintillant reactant .

  • Data analysis: Calculate Ki values using the formula: Ki = IC50/(1+[radioligand concentration]/Kd), accounting for the high affinity of [3H]Nα-methylhistamine (Kd ≈ 0.8 nM) .

For comparative studies between species, it's crucial to maintain identical assay conditions when testing both rat and human receptors to accurately determine species-specific differences in pharmacology.

How should researchers assess constitutive activity of the rat H3 receptor?

Constitutive activity assessment of the rat H3 receptor requires specific experimental approaches:

  • [35S]GTPγS binding assays: This is the gold standard for measuring constitutive GPCR activity. The expression of rH3R generates increased basal [35S]GTPγS binding that can be reduced by inverse agonists like thioperamide, ciproxifan, and FUB 465 .

  • GTPγS competition assay: Measure the inhibition of [35S]GTPγS binding by unlabeled GTPγS. The expression of H3R generates a high-affinity binding site for GTPγS that can be modulated by agonists and inverse agonists .

  • Arachidonic acid release: Measure [3H]-arachidonic acid release from cells expressing rH3R. Inverse agonists decrease the basal release, indicating constitutive activity .

  • Controls: Include neutral antagonists (e.g., proxyfan) to block the effects of inverse agonists and confirm the specificity of observed constitutive activity .

  • Receptor density correlation: Measure receptor density using radioligand binding assays and correlate with constitutive activity. Studies show that constitutive activity correlates with receptor density, with significant activity observable at physiological densities (<500 fmol mg-1 protein) .

Research has demonstrated that the rat H3 receptor exhibits one of the highest levels of constitutive activity among G-protein-coupled receptors in the rat brain .

How do specific amino acid differences in TM3 affect ligand binding and pharmacology between rat and human H3 receptors?

The pharmacological differences between rat and human H3 receptors are primarily attributed to two critical amino acid residues in the third transmembrane domain (TM3):

  • A119T and V122A substitutions: These residues located near Asp114 (which forms salt bridges with the ammonium group of histamine) are responsible for species-specific ligand binding profiles .

  • Ligand-specific effects:

    • Thioperamide binds with higher affinity to rat H3R (Ki = 4 nM) compared to human H3R (Ki = 58 nM), representing a ~14-fold difference .

    • Ciproxifan shows approximately 10-fold higher potency at rat versus human H3R .

    • FUB 349 displays reversed preference, binding with higher affinity to human H3R .

    • Some ligands (histamine, (R)α-methylhistamine, proxyfan, clobenpropit) show similar affinities at both species' receptors .

  • Mutational studies: Single mutation of V122A partially changes the discrimination patterns of ciproxifan and FUB 349, while combined mutation of both A119T and V122A fully abolishes the species differences in pharmacology .

  • Structural implications: These findings suggest that these two residues form part of the binding pocket that accommodates the diverse chemical structures of H3R ligands, particularly affecting the binding of imidazole-containing compounds such as thioperamide and ciproxifan.

This information is crucial when designing pharmacological studies and interpreting data across species, as compounds with promising activity in rat models may show significantly different potencies in human systems.

What are the known splice variants of rat H3 receptor and how do they impact experimental design?

Rat H3 receptor exists in multiple splice variant isoforms that should be considered when designing experiments:

  • Major rat H3R isoforms:

    • rH3R-445: The full-length isoform (445 amino acids)

    • rH3R-413: Contains a deletion in ICL3 segment D (ΔR274-S305)

    • rH3R-410: Contains an extended deletion in segments D and part of E

    • rH3R-397: Another variant with ICL3 deletions

    • rH3R-94: A truncated isoform consisting of only the N-terminal tail, TM1, ICL1, and part of TM2

  • Functional implications:

    • Different isoforms exhibit distinct pharmacological profiles and signaling properties

    • Some truncated isoforms may not be responsive to histamine in functional assays

    • Isoforms may form heterodimers with different pharmacological properties

  • Experimental considerations:

    • Primer design: When amplifying H3R from rat tissue, primers should be designed to distinguish between isoforms

    • Expression analysis: qPCR should use primers that can detect specific splice variants

    • Interpretation of pharmacological data: Results may vary depending on which isoform predominates in the experimental system

    • Tissue specificity: Different brain regions may express different isoform profiles

  • Species comparison: While some splice events are conserved across species (such as the segment D deletion in ICL3), others are species-specific, highlighting the importance of characterizing the specific isoforms present in experimental samples .

Researchers should verify which isoform(s) they are working with, especially when using native tissues where multiple variants may be expressed simultaneously.

What are the key considerations when developing functional assays for rat H3 receptor activity?

When developing functional assays for rat H3 receptor activity, researchers should consider:

  • Signaling pathway selection:

    • cAMP inhibition: The H3R primarily couples to Gi/o proteins, inhibiting forskolin-stimulated cAMP production

    • [35S]GTPγS binding: Directly measures G-protein activation and is sensitive to both agonists and inverse agonists

    • Arachidonic acid release: Provides a downstream readout of receptor activation

  • Receptor density effects:

    • Constitutive activity correlates with receptor density

    • Physiologically relevant densities (200-300 fmol mg-1 protein) are recommended for meaningful results

    • Studies comparing rat and human receptors should normalize expression levels

  • Control compounds:

    • Positive controls: (R)α-methylhistamine (agonist), histamine (endogenous ligand)

    • Negative controls: Thioperamide (inverse agonist for rat H3R, Ki = 4 nM)

    • Neutral antagonists: Proxyfan (blocks both agonists and inverse agonists without affecting basal activity)

  • Species-specific pharmacology:

    • Thioperamide and ciproxifan are approximately 10-fold more potent at rat versus human H3R

    • Some compounds like chloroproxyfan behave as full agonists at rat H3R but may have different efficacy at human H3R

  • Data analysis considerations:

    • EC50/IC50 determination: Use multiple concentrations spanning at least 3 log units

    • Efficacy measurements: Express relative to a reference full agonist (typically histamine)

    • For inverse agonists: Compare to basal activity and maximum inhibition by reference compounds

How should researchers account for constitutive activity when analyzing rat H3 receptor pharmacology data?

Accounting for constitutive activity is critical when analyzing rat H3 receptor pharmacology:

  • Baseline determination:

    • Use systems with minimal or no H3R expression as true baseline controls

    • Include neutral antagonists (e.g., proxyfan) to define the receptor-specific component of constitutive activity

  • Pharmacological classification framework:

    • Full agonists: Compounds producing maximal activation (≥90% of histamine response)

    • Partial agonists: Compounds with submaximal efficacy

    • Neutral antagonists: Compounds blocking both agonists and inverse agonists without affecting basal activity

    • Partial inverse agonists: Compounds partially reducing constitutive activity

    • Full inverse agonists: Compounds maximally reducing constitutive activity

  • Window of detection:

    • Systems with higher constitutive activity provide larger windows for detecting inverse agonism

    • The rat H3R typically shows higher constitutive activity than human H3R in [35S]GTPγS binding assays

  • Data normalization approaches:

    • Normalize to basal activity (0%) and maximum stimulation by a reference agonist (100%)

    • For inverse agonists, set basal activity as 0% and maximum inhibition by a reference inverse agonist as -100%

  • Statistical analysis:

    • Use one-way ANOVA with appropriate post-hoc tests to compare multiple compounds

    • Calculate EC50/IC50 values from concentration-response curves using non-linear regression

Constitutive activity of native rat H3Rs is considered among the highest of G-protein-coupled receptors present in rat brain, making it an important factor in accurate pharmacological characterization .

What are the common pitfalls in comparing pharmacological data between rat and human H3 receptors?

When comparing pharmacological data between rat and human H3 receptors, researchers should be aware of several potential pitfalls:

  • Unequal receptor expression levels:

    • Different expression levels can affect apparent potency and efficacy

    • Constitutive activity correlates with receptor density

    • Solution: Normalize receptor expression using radioligand binding to ensure comparable density (200-300 fmol mg-1 protein is physiologically relevant)

  • Species-specific pharmacology misinterpretation:

    • Thioperamide and ciproxifan are approximately 10-fold more potent at rat than human H3R

    • Misinterpreting decreased potency at human receptors as a pharmacological subtype rather than a species difference

    • Solution: Include well-characterized reference compounds for each species

  • Isoform heterogeneity:

    • Different splice variants may predominate in different experimental systems

    • Rat and human tissues express different isoform profiles

    • Solution: Characterize the specific isoforms present using PCR or Western blotting

  • Assay condition variations:

    • Different buffer compositions, incubation times, or temperatures can affect results

    • Solution: Standardize assay conditions when comparing across species

  • Signaling pathway differences:

    • Coupling efficiency to different G-proteins may vary between species

    • Solution: Use multiple readouts (GTPγS binding, cAMP inhibition, arachidonic acid release) to fully characterize signaling

  • Data analysis inconsistencies:

    • Using different analysis methods for rat versus human data

    • Solution: Apply identical analytical approaches to both datasets

A key example from the literature demonstrates how the low affinity of thioperamide for the human H3 receptor (Ki = 58 nM) compared to the rat receptor (Ki = 4 nM) represents a true species difference in pharmacology rather than indicating a novel pharmacological subtype .

What methodology is recommended for studying H3 receptor-mediated [35S]GTPγS binding?

For studying H3 receptor-mediated [35S]GTPγS binding, researchers should follow these methodological recommendations:

  • Membrane preparation:

    • For recombinant systems: Prepare membranes from CHO or HEK293 cells stably expressing rat H3R

    • For native systems: Prepare membranes from rat brain regions (cerebral cortex, striatum, hypothalamus)

    • Homogenize tissues in ice-cold buffer and collect membrane pellets by centrifugation

  • Assay conditions:

    • Buffer: HEPES or Tris buffer (50 mM, pH 7.0-7.4)

    • GDP concentration: 10 μM (critical for reducing basal binding and improving signal window)

    • [35S]GTPγS concentration: 0.1-0.5 nM

    • Incubation temperature: 25-30°C

    • Incubation time: 30-60 minutes

  • Experimental design:

    • Include positive controls: Histamine or (R)α-methylhistamine as agonists

    • Include negative controls: Thioperamide or ciproxifan as inverse agonists

    • Include neutral antagonists: Proxyfan to block both agonist and inverse agonist effects

    • Perform concentration-response curves spanning at least 3 log units

  • Data analysis:

    • Express data as percentage stimulation or inhibition relative to basal binding

    • For inverse agonists, calculate IC50 values using non-linear regression

    • For complex pharmacology, consider using operational models that account for constitutive activity

  • Validation approaches:

    • Correlation with receptor density: Measure receptor expression using radioligand binding

    • Specificity controls: Include H3R blockers to confirm receptor-mediated effects

    • Tissue/region specificity: Compare binding across different brain regions

This methodology has successfully demonstrated that inverse agonists like thioperamide, ciproxifan, and FUB 465 decrease [35S]GTPγS binding to rat brain membranes in several regions, with effects blocked by the neutral antagonist proxyfan .

How predictive are rat H3 receptor pharmacological profiles for human H3 receptor activity?

The predictive value of rat H3 receptor pharmacology for human applications requires careful consideration:

  • Correlation patterns:

    • Agonists: Histamine, (R)α-methylhistamine, and other agonists generally show similar potencies at both rat and human H3 receptors, making rat data relatively predictive for these compounds .

    • Antagonists/inverse agonists: Significant species differences exist, with thioperamide and ciproxifan being approximately 10-fold more potent at rat H3R than human H3R .

    • Some compounds like FUB 349 show reverse selectivity, being more potent at human than rat H3R .

  • Structural basis:

    • Two amino acids in TM3 (A119T and V122A) account for most species differences .

    • Compounds interacting with these residues will show more pronounced species differences.

    • Understanding the binding mode can help predict whether a compound will maintain its profile across species.

  • Predictivity table:

    Compound ClassRat-to-Human PredictivityKey Considerations
    Histamine-like agonistsHighSimilar potencies across species
    Imidazole-containing antagonistsLow10-fold lower potency in humans
    Non-imidazole antagonistsVariableStructure-dependent
    Neutral antagonists (e.g., proxyfan)HighSimilar profiles across species
  • Recommendations for translational research:

    • Test compounds on both rat and human receptors early in discovery

    • Focus on compounds with minimal species differences for translational studies

    • Consider the target binding site - compounds binding away from the TM3 region may show more consistent cross-species profiles

    • Use humanized rat models or human receptor knock-in approaches for critical preclinical studies

What are the key considerations when using recombinant rat H3 receptors for drug discovery applications?

When using recombinant rat H3 receptors for drug discovery, researchers should consider:

  • Species differences:

    • Systematically test compounds on both rat and human H3 receptors

    • Focus on compounds with minimal species differences for translational potential

    • Consider dual-species screening cascades to identify compounds with consistent profiles

  • Receptor isoforms:

    • Different H3R splice variants exhibit distinct pharmacological profiles

    • Ensure the recombinant system expresses the appropriate isoform for the target indication

    • Consider screening against multiple isoforms for comprehensive characterization

  • Expression system optimization:

    • Maintain physiologically relevant receptor densities (200-300 fmol mg-1 protein)

    • High overexpression may exaggerate constitutive activity and inverse agonism

    • Use inducible expression systems to control receptor levels

  • Assay selection:

    • Primary screening: Radioligand binding with [3H]Nα-methylhistamine

    • Secondary functional assays: [35S]GTPγS binding, cAMP inhibition, or arachidonic acid release

    • Counter-screening: Test for selectivity against other histamine receptor subtypes (H1, H2, H4) and related GPCRs

  • Pharmacological diversity:

    • Develop assays to identify different pharmacological profiles:

      • Full and partial agonists

      • Neutral antagonists

      • Partial and full inverse agonists

    • Consider desirable profiles based on therapeutic hypothesis

  • CNS penetration:

    • Since H3R is predominantly expressed in the CNS, optimize compounds for blood-brain barrier penetration

    • Consider brain/plasma ratios in early ADME studies

By addressing these considerations, researchers can enhance the translational value of data generated using recombinant rat H3 receptors and improve the success rate of drug discovery programs targeting this receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.