Recombinant Rat Histamine H4 receptor (Hrh4)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Hrh4

The rat Hrh4 receptor shares structural and functional homology with human HRH4, featuring seven transmembrane domains typical of rhodopsin-like GPCRs. Key molecular features include:

PropertyDetails
Gene ID225192 (Rat)
Protein Length391 amino acids
Subcellular LocalizationCell membrane
Constitutive ActivityExhibits ligand-independent signaling under baseline conditions
Ligand BindingBinds histamine and synthetic agonists (e.g., 4-methylhistamine)

The receptor is encoded by the Hrh4 gene (synonyms: H4R, BG26, GPCR105) and is expressed in immune cells, adipocytes, and peripheral tissues .

Immune Regulation

  • Mast cell chemotaxis: Hrh4 activation induces actin polymerization via phospholipase C, driving mast cell migration to inflammation sites .

  • Eosinophil recruitment: Mediates histamine-dependent eosinophil infiltration in allergic responses .

Metabolic Adaptation

  • Adipose tissue browning: Cold exposure upregulates Hrh4 in subcutaneous white adipose tissue (scWAT), promoting thermogenesis and lipolysis via UCP1 and HSL activation .

  • Energy expenditure: Knockdown of Hrh4 in scWAT reduces oxygen consumption and cold tolerance in mice .

Research Applications

Recombinant Hrh4 is utilized in preclinical models to study:

  • Inflammation: Hrh4 antagonists reduce colitis severity in TNBS-induced rat models by suppressing neutrophil infiltration and IL-6 production .

  • Pruritus: Hrh4-mediated ERK activation in spinal neurons contributes to chronic itch, making it a therapeutic target for dermatological conditions .

  • Cancer: Emerging evidence links Hrh4 to tumorigenesis, particularly in Leydig cell tumors .

Experimental Tools

  • Agonists/Antagonists:

    • 4-Methylhistamine (4MH): Selective Hrh4 agonist used to induce scWAT browning and lipolysis in murine models .

    • JNJ7777120: Antagonist shown to ameliorate experimental colitis by blocking eosinophil recruitment .

  • Antibodies: Polyclonal antibodies (e.g., bs-10993R) enable Hrh4 detection in Western blot, ELISA, and immunohistochemistry .

Clinical Implications

Hrh4 modulation holds therapeutic potential for:

  • Metabolic disorders: Enhancing thermogenesis via Hrh4 activation could combat obesity .

  • Autoimmune diseases: Antagonists may mitigate pathologies like rheumatoid arthritis and atopic dermatitis .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Hrh4; Histamine H4 receptor; H4R; HH4R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSESNGTDVLPLTAQVPLAFLMSLLAFAITIGNAVVILAFVADRNLRHRSNYFFLNLAIS DFFVGVISIPLYIPHTLFNWNFGSGICMFWLITDYLLCTASVYSIVLISYDRYQSVSNAV RYRAQHTGILKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTEECEPGFVTEWYILAIT AFLEFLLPVSLVVYFSVQIYWSLWKRGSLSRCPSHAGFIATSSRGTGHSRRTGLACRTSL PGLKEPAASLHSESPRGKSSLLVSLRTHMSGSIIAFKVGSFCRSESPVLHQREHVELLRG RKLARSLAVLLSAFAICWAPYCLFTIVLSTYRRGERPKSIWYSIAFWLQWFNSLINPFLY PLCHRRFQKAFWKILCVTKQPAPSQTQSVSS
Uniprot No.

Target Background

Function
The H4 subclass of histamine receptors is known to mediate histamine signals in peripheral tissues. It exhibits a significant level of constitutive activity, meaning it displays spontaneous activity even in the absence of an agonist.
Gene References Into Functions
  1. A recent study found that blocking H4R significantly reduced inflammation 2 hours after Lipopolysaccharide injection, inhibiting the expression of pro-inflammatory Tumor Necrosis Factor-alpha and NF-kappaB. PMID: 25666529
  2. Research indicates that histamine H4 receptor (HRH4) is present in Leydig cells of all testicular sections, as evidenced by positive immunostaining. PMID: 25253872
  3. The H4 receptor is predominantly expressed in resident renal cells of the loop of Henle within the kidney. Notably, it is significantly overexpressed in diabetic animals, suggesting a potential role in the pathogenesis of diabetes-associated renal disease. PMID: 23262779
  4. Histamine effectively inhibits the release of interleukin (IL)-1beta induced by lipopolysaccharide in hippocampal organotypic slice cultures. PMID: 22569158
  5. H4 receptors are primarily involved in regulating the excitability of vestibular primary neurons through histaminergic mechanisms. PMID: 22624822
  6. This study involved fragment optimization and analysis of binding kinetics for ligand-based design of novel histamine H receptor antagonists. PMID: 22153663
  7. These findings suggest, for the first time, a possible ulcerogenic role mediated by histamine H4 receptors in the rat gastric mucosa. PMID: 21839070
  8. The histamine H4 receptor is closely associated with allergic rhinitis and plays a significant role in its pathogenesis. PMID: 21055325
  9. H(4) mRNA was detected in the cortex, cerebellum, brainstem, amygdala, thalamus, and striatum. Lower levels were detected in the hypothalamus, and none was found in the hippocampus. Notably, strong expression of H(4) mRNA was observed in the dorsal root ganglion and spinal cord. PMID: 19046950
  10. This research analyzed how quinazolines can function as inverse agonists for the histamine H4 receptor. PMID: 19053770
  11. The results do not suggest a role for histamine H4 receptors in controlling intestinal neurotransmission in rats. PMID: 19271139
  12. Histamine H4 receptors are functionally expressed on neurons, which has significant implications for their therapeutic potential in neurology and psychiatry. PMID: 19413571

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the rat histamine H4 receptor?

The rat histamine H4 receptor (Hrh4) belongs to the G protein-coupled receptor (GPCR) family and primarily couples to Gαi proteins. Its activation leads to inhibition of adenylyl cyclase activity, resulting in decreased cytosolic cAMP levels. Additionally, H4R engagement triggers phospholipase C activation and mobilization of calcium from intracellular stores . The receptor shows approximately 37% genetic homology with the histamine H3 receptor, while displaying less than 30% homology with H1R, H2R, and other biogenic amine receptors .

H4R possesses a distinct ligand binding pocket that significantly differs from that of H1R. Recent structural studies have revealed that when histamine binds to H4R, the imidazole ring is oriented toward TM7 to interact with F344^7.39, which contrasts with H1R binding where the imidazole ring orients toward TM5 and TM3 .

How is H4R expression distributed in rat tissues?

H4R demonstrates a distinctive expression pattern across rat tissues. In the central nervous system, H4R is prominently expressed in:

  • Thalamus (particularly posterior nuclei)

  • Layer IV of the cerebral cortex

  • Entorhinal cortex

  • CA4 stratum lucidum of the hippocampus

Outside the brain, H4R expression has been detected in:

  • Immune cells (eosinophils, mast cells, dendritic cells)

  • Leydig cells of rats aged 7-240 days

  • Male gametes (in 21-day-old rats)

The unique distribution pattern suggests specialized functions in different physiological systems, with relatively low expression observed in the striatum .

What are the key signaling pathways mediated by H4R activation?

H4R primarily signals through the following pathways:

  • G protein-dependent mechanisms:

    • Coupling to Gαi proteins

    • Inhibition of adenylyl cyclase (reducing cAMP)

    • Activation of phospholipase C

    • Mobilization of intracellular calcium

  • G protein-independent mechanisms:

    • Recruitment of β-arrestin 2

    • Activation of mitogen-activated protein kinase (MAPK) cascade

    • Receptor desensitization and internalization

In specific cell types like Th2 cells and monocyte-derived dendritic cells (MoDC), H4R activation induces pro-inflammatory AP-1. It also reduces production of Th1-associated cytokines IL-12 and IP10 in MoDC, suggesting that histamine may shape a Th2-biased immune response via these mechanisms .

What are the most effective methods for expressing and purifying recombinant rat H4R for in vitro studies?

For successful expression and purification of recombinant rat H4R, consider the following methodological approach:

  • Expression System Selection:

    • Mammalian cell lines (HEK293, CHO) maintain appropriate post-translational modifications

    • Baculovirus-infected insect cells provide higher protein yields while maintaining functionality

    • Bacterial systems can be used for specific domains but may lack proper folding for full-length receptor

  • Purification Strategy:

    • Add affinity tags (His, FLAG) to facilitate purification

    • Use detergent solubilization (DDM, LMNG) to extract receptor from membranes

    • Employ sequential chromatography steps (affinity, ion exchange, size exclusion)

    • Consider lipid reconstitution for maintaining native conformation

  • Functional Validation:

    • Perform radioligand binding assays to confirm ligand recognition

    • Conduct BRET-based G protein activation assays to verify signaling competence

    • Use calcium mobilization assays to assess functional coupling

Quality control should include assessment of homogeneity by SDS-PAGE and Western blotting, thermal stability measurements, and verification of pharmacological properties against known H4R ligands.

How can I establish reliable binding assays for rat H4R characterization?

Establishing reliable binding assays for rat H4R requires careful consideration of several parameters:

  • Radioligand Selection:

    • [^3H]-histamine provides direct measurement of native ligand binding

    • [^3H]-JNJ7777120 offers higher specificity for competitive binding studies

    • Selection should be based on affinity, specific activity, and experimental goals

  • Assay Optimization:

    • Buffer composition (pH 7.4, physiological ions)

    • Protein concentration (typically 10-50 μg/mL)

    • Incubation time and temperature (equilibrium conditions)

    • Separation method for bound/free ligand (filtration vs. centrifugation)

  • Data Analysis:

    • Determine total binding, non-specific binding, and specific binding

    • Calculate binding parameters (K_d, B_max) using appropriate curve fitting

    • Analyze competition binding for inhibitor constants (K_i)

For high-throughput screening, consider adapting to fluorescence-based assays using fluorescently labeled ligands or functional readouts like GTPγS binding that reflect receptor activation.

A validation step comparing the binding parameters of reference compounds (histamine, JNJ7777120, clobenpropit) with literature values is essential to confirm assay reliability .

What cell-based assays are most appropriate for evaluating rat H4R functional activity?

Several complementary cell-based assays can effectively evaluate rat H4R functional activity:

  • BRET-based G protein activation assays:

    • Directly measures Gαi protein recruitment to H4R

    • Provides real-time kinetic data on receptor activation

    • Allows quantification of ligand efficacy and potency

  • cAMP inhibition assay:

    • Measures reduction in forskolin-stimulated cAMP levels

    • Can be performed using ELISA, radioimmunoassay, or FRET-based methods

    • Reflects the primary signaling outcome of H4R activation

  • Calcium flux assays:

    • Uses fluorescent calcium indicators (Fluo-4, Fura-2)

    • Captures [Ca²⁺]ᵢ mobilization from intracellular stores

    • Provides high temporal resolution of receptor activation

  • β-arrestin recruitment assays:

    • Detects G protein-independent signaling

    • Uses enzyme complementation or BRET/FRET technologies

    • Useful for identifying biased ligands

  • Electrophysiological approaches:

    • Patch-clamp recordings directly measure H4R-mediated hyperpolarization

    • Can detect outwardly rectifying currents in neurons

    • Valuable for neurophysiological investigations

For more physiologically relevant assessments, functional readouts in primary cells like chemotaxis assays with eosinophils or steroidogenesis assays in Leydig cells can provide context-specific information about receptor function .

How does rat H4R differ structurally and functionally from human H4R?

Rat H4R shares approximately 69% sequence homology with human H4R, with key differences that impact pharmacological properties:

Structural Differences:

  • Variations in the transmembrane domains affect ligand binding pocket architecture

  • Differences in extracellular loop regions influence ligand access and binding kinetics

  • Amino acid substitutions at key positions alter the electrostatic surface of the binding pocket

Functional Differences:

  • Species-specific pharmacology with differential response to certain antagonists

  • Variations in potency and efficacy of reference compounds

  • Different affinities for endogenous histamine (rat typically showing lower affinity)

Pharmacological Implications:

  • JNJ7777120, a selective antagonist for human H4R, may display different potency or even biased signaling in rat H4R

  • Clobenpropit exhibits species-dependent pharmacological profiles

  • These differences necessitate careful validation when translating findings between species

When designing experiments, researchers should account for these species differences by establishing dose-response relationships specific to rat H4R and avoiding direct extrapolation of human H4R pharmacology.

What role does H4R play in inflammatory and immune-mediated conditions in rat models?

H4R plays multiple roles in inflammatory and immune-mediated conditions in rat models:

  • Rheumatoid Arthritis:

    • H4R promotes osteoclastogenesis in RA models

    • Histamine and Th17 cytokines induce RANKL expression via H4R

    • H4R antagonism (JNJ7777120) reduces RANKL expression and osteoclast differentiation

    • This suggests H4R blockade could prevent bone destruction in RA

  • Inflammatory Bowel Disease:

    • Histamine concentrations rise in affected gut tissues during inflammation

    • Histamine-deficient mice show reduced severity of experimentally induced gut inflammation

    • H4R activation shapes Th2-biased immune responses by:

      • Reducing production of Th1-associated cytokines (IL-12, IP10)

      • Attracting and activating eosinophils, mast cells, and dendritic cells

  • Neuroinflammation:

    • H4R expression in specific brain regions suggests roles in neuroinflammatory processes

    • H4R agonists like 4-methyl histamine directly hyperpolarize neurons in layer IV of mouse somatosensory cortex

    • This hyperpolarization is blocked by selective H4R antagonist JNJ10191584

The dual roles of H4R in promoting inflammation while potentially shifting immune responses from Th1/Th17 toward Th2 phenotypes make it a complex target for therapeutic intervention, requiring careful characterization in specific disease models.

How do H4R-mediated signaling pathways interact with other inflammatory mediators?

H4R signaling demonstrates complex interactions with other inflammatory pathways:

  • Cytokine Networks:

    • H4R activation modulates the production of Th1 vs. Th2 cytokines

    • IL-6, IL-17, IL-21, and IL-22 can induce H4R expression in monocytes

    • H4R activation can shape cytokine responses toward a Th2 bias by inhibiting IL-12 and IP10 production

  • Osteoclastogenesis Pathway:

    • H4R synergizes with IL-17 and IL-22 to stimulate RANKL expression

    • The interaction between H4R and Th17 cytokines enhances osteoclast differentiation

    • H4R antagonism with JNJ7777120 reduces this synergistic effect

  • Cross-talk with Other Histamine Receptors:

    • Co-expression of multiple histamine receptor subtypes creates complex signaling networks

    • Cell type-specific expression patterns determine the predominant response

    • The net effect depends on the balance between pro-inflammatory (primarily H1R and H4R) and anti-inflammatory (primarily H2R) receptor activation

  • Steroidogenesis Pathways:

    • H4R activation inhibits LH/hCG-induced cAMP production

    • H4R signaling reduces StAR protein expression, a key regulator of steroidogenesis

    • This represents a novel interaction between histaminergic and steroidogenic pathways

These complex interactions highlight the need for systems biology approaches to fully understand H4R's role in inflammatory networks and to design targeted therapeutic strategies.

What are the common pitfalls in H4R-targeted experiments and how can they be avoided?

Researchers frequently encounter several challenges when working with H4R:

  • Ligand Selectivity Issues:

    • Challenge: Many H4R ligands display activity at other histamine receptors

    • Solution: Use multiple structurally distinct ligands and validate with knockout controls

    • Recommendation: Include JNJ7777120 as a reference antagonist and validate with siRNA knockdown

  • Species Differences:

    • Challenge: Rat H4R pharmacology differs from human H4R

    • Solution: Establish species-specific dose-response relationships

    • Recommendation: Do not directly extrapolate potency values across species without validation

  • Expression Level Variability:

    • Challenge: Inconsistent receptor expression affects experimental reproducibility

    • Solution: Quantify receptor expression using radioligand binding or qPCR

    • Recommendation: Normalize functional responses to expression levels when comparing conditions

  • Signaling Pathway Bias:

    • Challenge: Different assays may detect different signaling outcomes

    • Solution: Use multiple complementary assays (G protein activation, cAMP, calcium, β-arrestin)

    • Recommendation: Compare signaling profiles systematically using bias plots

  • Background Histamine:

    • Challenge: Endogenous histamine can confound experiments

    • Solution: Culture cells in histamine-free media and control for histamine in biological samples

    • Recommendation: Include histamine measurements in experimental design

Careful experimental design with appropriate controls and validation steps at each stage can minimize these pitfalls and enhance data reliability.

How can mutagenesis approaches be used to study H4R structure-function relationships?

Mutagenesis provides powerful insights into H4R structure-function relationships:

  • Key Binding Pocket Residues:
    Recent structural studies have identified critical residues for H4R function that can be targeted for mutagenesis:

    ResiduePositionFunctionEffect of Mutation
    D943.32Determines orientation of positively charged ligandsD94A/N abolishes histamine binding and activation
    Y953.33Forms part of binding pocketY95A decreases histamine binding
    E1825.46Regulates receptor activityE182A/Q reduces histamine binding and activation
    Y3196.51Contributes to binding pocketY319A causes substantial decrease in histamine binding
    F3447.39Interacts with imidazole ring of histamineF344A dramatically decreases histamine binding
    Q3477.42Forms part of binding pocketQ347A shows substantial decrease in histamine binding
    W3487.43Critical for receptor functionW348A completely abolishes receptor activation

    These mutations can be strategically designed to:

    • Alter ligand selectivity

    • Modify efficacy of ligands (converting agonists to antagonists)

    • Create constitutively active or inactive receptors

  • Mutagenesis Approaches:

    • Alanine scanning to identify functionally important residues

    • Conservative substitutions to probe specific interactions

    • Gain-of-function mutations to enhance specific properties

    • Chimeric receptors to define domain-specific functions

  • Functional Characterization of Mutants:
    Each mutant should be characterized using:

    • Ligand binding assays to determine affinity changes

    • BRET-based G protein activation assays to assess signaling

    • β-arrestin recruitment assays to evaluate biased signaling

Notably, E182^5.46 mutations have been shown to convert the agonist clobenpropit into an inverse agonist, demonstrating how mutagenesis can reveal pharmacological switching mechanisms that may be exploited for drug development .

What are the considerations for developing selective H4R agonists and antagonists for research applications?

Developing selective H4R ligands requires addressing several important considerations:

  • Structural Determinants of Selectivity:

    • Target the unique binding mode where histamine's imidazole ring orients toward TM7 in H4R

    • Exploit differences in the electrostatic surface of the binding pocket

    • Focus on interactions with key residues like D94^3.32, F344^7.39, and E182^5.46

  • Pharmacophore Requirements:

    • Include a basic nitrogen for interaction with D94^3.32

    • Incorporate aromatic moieties that can engage in π-π interactions

    • Consider spacer length and flexibility between pharmacophoric elements

    • Balance lipophilicity for membrane permeability while maintaining solubility

  • Selectivity Screening:

    • Test against all histamine receptor subtypes (H1R, H2R, H3R, H4R)

    • Screen against structurally related GPCRs to avoid off-target effects

    • Evaluate species selectivity (particularly between rat and human H4R)

  • Functional Characterization:

    • Assess multiple signaling pathways to identify biased ligands

    • Determine full dose-response curves for accurate efficacy and potency determination

    • Consider tissue-specific effects in relevant cellular models

  • Physicochemical and ADME Properties:

    • Optimize solubility and stability for experimental applications

    • Consider brain penetration for CNS studies

    • Design appropriate control compounds (inactive analogs)

Current reference compounds include JNJ7777120 (selective antagonist), clobenpropit and VUF6884 (agonists with some selectivity issues), and 4-methyl histamine (H4R-preferring agonist) . Developing improved tool compounds with enhanced selectivity remains an important goal for advancing H4R research.

How should contradictory findings about H4R function in different model systems be reconciled?

Researchers often encounter contradictory findings when studying H4R across different models. A systematic approach to reconciling these discrepancies includes:

  • Consider Species Differences:

    • Rat and human H4R show approximately 69% sequence homology

    • Some ligands display species-dependent pharmacology

    • The antagonist JNJ7777120 may exhibit biased signaling in different species

  • Evaluate Experimental Context:

    • Cell type-specific expression of signaling components

    • Different assay systems measuring distinct outcomes

    • Variations in receptor expression levels affecting signaling efficacy

  • Examine Receptor Interactome:

    • Co-expression with other histamine receptors

    • Presence of specific G proteins and β-arrestins

    • Formation of receptor heteromers altering signaling properties

  • Account for Ligand-Specific Effects:

    • Biased signaling (preferential activation of specific pathways)

    • Differences in intrinsic efficacy across systems

    • Off-target effects at higher concentrations

A methodological framework for addressing contradictions includes:

  • Parallel testing in multiple systems

  • Genetic validation (siRNA, CRISPR-Cas9)

  • Use of multiple structurally distinct ligands

  • Comprehensive signaling pathway analysis

For example, contradictory findings regarding H4R's role in Th1/Th17-driven pathologies like Crohn's disease might be reconciled by understanding the context-dependent balance between pro-inflammatory and immunomodulatory effects .

What are the best practices for translating findings from rat H4R studies to human applications?

When translating findings from rat H4R to human applications, consider these best practices:

  • Cross-Species Pharmacological Validation:

    • Systematically compare ligand potency and efficacy between rat and human H4R

    • Establish species-specific structure-activity relationships

    • Identify conserved binding modes and signaling outcomes

  • Structural Homology Analysis:

    • Focus on conserved residues in the binding pocket

    • Understand how species differences influence ligand recognition

    • Use homology models to predict translational potential

  • Parallel Assay Systems:

    • Test key hypotheses in both rat and human cell systems

    • Employ identical experimental conditions and readouts

    • Compare primary cells from both species when possible

  • Pathway Conservation Assessment:

    • Verify that downstream signaling mechanisms are conserved

    • Identify species-specific signaling components

    • Determine if biological outcomes are preserved across species

  • Translational Models:

    • Use humanized mice expressing human H4R

    • Validate findings in human ex vivo systems

    • Consider species differences when selecting in vivo models

The translational value of rat H4R studies is exemplified by research on inflammatory conditions like rheumatoid arthritis, where H4R antagonism reduces osteoclastogenesis in both rat models and human samples, suggesting conservation of this therapeutic mechanism .

How can H4R research findings contribute to therapeutic development for inflammatory conditions?

H4R research provides several promising avenues for therapeutic development:

  • Rheumatoid Arthritis:

    • H4R mediates RANKL expression and osteoclast differentiation

    • H4R antagonists (e.g., JNJ7777120) reduce osteoclastogenesis

    • This suggests H4R blockade could prevent bone destruction in RA

    • Targeting H4R might offer a novel mechanism distinct from current biologics

  • Inflammatory Bowel Disease:

    • H4R modulates Th1/Th2 balance in gut inflammation

    • H4R-mediated attraction and activation of immune cells contributes to pathology

    • Antagonism of H4R might reduce inflammatory cell recruitment

    • Understanding the potentially contrasting effects in Crohn's disease vs. ulcerative colitis is essential

  • Allergic Conditions:

    • H4R expression on key allergic effector cells (mast cells, eosinophils)

    • H4R modulates chemotaxis and cytokine production

    • Combined H1R/H4R antagonism might provide superior efficacy compared to H1R blockade alone

    • Dual-targeting approaches could address multiple aspects of allergic inflammation

  • Neuroinflammatory Disorders:

    • H4R's presence in specific brain regions suggests potential CNS targets

    • H4R agonists directly hyperpolarize neurons in layer IV of the somatosensory cortex

    • Understanding neuronal H4R function could open new therapeutic approaches

Despite promising preclinical findings, clinical trials of H4R ligands have shown only moderate beneficial effects so far. Future development should focus on:

  • Optimizing selectivity and pharmacokinetic properties

  • Identifying patient subpopulations most likely to benefit

  • Developing combination approaches with other anti-inflammatory agents

  • Understanding the complex role of H4R in disease-specific contexts

What are the emerging research directions for rat H4R in neuroscience applications?

The discovery of functional H4R expression in the rat brain opens several exciting research directions:

  • Neuronal Signaling Mechanisms:

    • Investigation of H4R-mediated hyperpolarization in layer IV cortical neurons

    • Characterization of H4R-activated outwardly rectifying currents

    • Analysis of potential interactions with other neurotransmitter systems

  • Regional Specialization:

    • Understanding the functional significance of H4R expression in:

      • Thalamus (particularly posterior nuclei)

      • Layer IV of cerebral cortex

      • Entorhinal cortex

      • Hippocampal CA4 stratum lucidum

    • Exploring region-specific signaling partners and outcomes

  • Neurodevelopmental Roles:

    • Investigation of age-dependent expression patterns

    • Analysis of H4R contributions to neural circuit formation

    • Potential roles in histamine-mediated developmental processes

  • Neuroinflammatory Modulation:

    • H4R-mediated crosstalk between neurons and immune cells

    • Potential neuroprotective or neurotoxic effects in inflammatory conditions

    • Development of CNS-penetrant H4R ligands for neurological applications

  • Synaptic Plasticity:

    • Effects on monosynaptic thalamocortical transmission

    • Potential contributions to long-term potentiation or depression

    • Roles in learning and memory processes

These research directions will require innovative approaches combining electrophysiology, optogenetics, chemogenetics, and advanced imaging techniques to fully elucidate the neurobiological functions of H4R.

How can advanced technologies enhance our understanding of H4R biology in rat models?

Cutting-edge technologies offer unprecedented opportunities to advance rat H4R research:

  • CRISPR-Cas9 Genome Editing:

    • Generation of H4R knockout rat models

    • Creation of rats expressing tagged H4R for visualization

    • Introduction of specific mutations to study structure-function relationships

    • Development of conditional knockout models for tissue-specific analysis

  • Single-Cell Transcriptomics:

    • High-resolution mapping of H4R expression across cell types

    • Identification of co-expressed signaling components

    • Analysis of transcriptional responses to H4R activation

    • Discovery of previously unknown H4R-expressing cell populations

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for subcellular H4R localization

    • In vivo imaging using fluorescent H4R ligands

    • FRET/BRET sensors for real-time signaling analysis

    • Intravital microscopy to observe H4R-mediated immune cell dynamics

  • Cryo-EM and Structural Biology:

    • Determination of rat H4R structure in different activation states

    • Comparison with human H4R to guide translational research

    • Structure-based design of selective ligands

    • Analysis of H4R interactions with signaling partners

  • Systems Biology Approaches:

    • Network analysis of H4R signaling pathways

    • Integration of proteomics, transcriptomics, and metabolomics data

    • Computational modeling of H4R-mediated physiological responses

    • Prediction of off-target effects and drug interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.