Recombinant Rat Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (Herpud2)

Shipped with Ice Packs
In Stock

Description

Introduction

The Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (Herpud2), also known as HERP2, is a protein that participates in the endoplasmic reticulum-associated degradation (ERAD) pathway . ERAD is a crucial process for maintaining cellular health by eliminating misfolded proteins from the endoplasmic reticulum (ER) . Herpud2 is integral to the unfolded protein response (UPR), a mechanism activated when unfolded or misfolded proteins accumulate in the ER .

Discovery and Structure

Herpud2 was identified as a homolog of HERP1 (Homocysteine-Responsive ER Protein 1) . It shares approximately 38% sequence identity and 51% homology with HERP1 . Similar to HERP1, Herpud2 contains an N-terminal ubiquitin-like (UBL) domain and a hydrophobic segment near its C-terminus . Subcellular localization studies have confirmed that Herpud2 is predominantly located in the ER . Both the N and C termini of Herpud2 are exposed to the cytosol .

Function in ERAD

Herpud2 plays a significant role in ERAD, where it functions in conjunction with HERP1 . While depletion of HERP1 alone has a minor inhibitory effect on the degradation of certain substrates, the simultaneous depletion of both HERP1 and Herpud2 results in a much stronger stabilization of ERAD substrates . This indicates that HERP1 and Herpud2 have partially redundant functions in ERAD .

Herpud2 is involved in the degradation of both glycosylated and non-glycosylated proteins . It participates in the degradation of substrates such as:

  • Sonic hedgehog C-terminal fragment (SHH-C)

  • Nonglycosylated SHH variant (N278A)

  • Null Hong Kong α1-antitrypsin (NHK)

Interaction with HRD1 Complex

Herpud2 is an integral component of the HRD1 complex, which is essential for retrotranslocation . Retrotranslocation involves moving misfolded proteins from the ER to the cytosol for degradation by the proteasome . Herpud2 interacts with HRD1, SEL1L, and DERL2, which are key components of the HRD1 complex . It helps recruit DERL2 to the HRD1-SEL1L complex, facilitating the organization of an active retrotranslocation complex .

Role in Unfolded Protein Response (UPR)

Herpud2 is predicted to be involved in the UPR pathway . The UPR is activated in response to ER stress, which occurs when misfolded proteins accumulate in the ER . Herpud2 is thought to coordinate the recruitment of HRD1 and misfolded proteins to the ER-derived quality control compartment (ERQC), a critical area for ERAD .

Regulation of HRD1-Mediated Ubiquitylation

Herp regulates HRD1-mediated ubiquitylation, a process necessary for tagging misfolded proteins for degradation . The ubiquitin-like (UBL) domain of Herp is essential for regulating HRD1-mediated ubiquitylation . ER stress increases the association of Herp with pre-existing HRD1 .

Clinical Significance

Studies suggest that HERPUD1, a related protein, may be a potential target for suppressing tumorigenesis in breast cancer cells, highlighting the broader clinical relevance of ER protein quality control mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Herpud2; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Herpud2
Target Protein Sequence
MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSG RLLPDHLQLKDILRKQDEYHMVHLVCASRSPPSSPKSSTDGESHGALASSTNSNSDHSDS TTPSPSQESLSLVAGSSEGLRHRTLPQAQTDPAQSHQFPYVIQGNVDHQFPGQGVPPGFP MYPAFSPLQMLWWQQMYAQQYYMQYQAAVTAQATSSASSAQHAASSPLNLAHVPGEEPPP APNLVAQENGPENVQMNAQGGPVLNEEDFNRDWLDWVYTFSRAAVLLSIVYFYSSFSRFI MVMGAMLLVYLHQAGWFPFRQEGGQQQAPNNVDANNEGQNANNLELEEMRLMDDGLEDES GEDAGEDASAAQRPGLMASAWSFITTFFTSLIPEGPPQVAN
Uniprot No.

Target Background

Function

Potentially involved in the unfolded protein response (UPR) pathway.

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Herpud2 and what is its relationship to Herpud1?

Herpud2 belongs to the HERPUD family of proteins that function in the endoplasmic reticulum-associated degradation (ERAD) pathway. It is related to Herpud1, with both proteins facilitating the retrotranslocation of unfolded ER proteins to the cytoplasm for degradation by the ubiquitin-proteasome system . The relationship between these proteins is characterized by partial functional redundancy, as they both serve as integral components of the HRD1 complex .

Studies have demonstrated that Herpud2 works semi-redundantly with Herpud1 for the degradation of specific ERAD substrates such as A1ATNHK (alpha-1 antitrypsin null Hong Kong variant) . Both proteins act as essential adaptors between HRD1 (an E3 ubiquitin ligase) and DERL2 (Derlin-2), helping to organize a functional retrotranslocation complex in HRD1-mediated ERAD .

FeatureHerpud1Herpud2
Cellular LocalizationEndoplasmic ReticulumEndoplasmic Reticulum
Function in ERADAdaptor in HRD1 complexAdaptor in HRD1 complex
Primary RoleRecruits DERL2 to HRD1Recruits DERL2 to HRD1
Expression in MuscleNot specified in available dataLower in myoblasts, higher in myotubes
Response to DenervationNot specified in available dataDifferentially regulated

How is Herpud2 expressed in skeletal muscle tissue?

Herpud2 exhibits distinctive expression patterns in skeletal muscle tissue, with important implications for muscle biology and pathology. Microarray analysis has revealed that Herpud2 is differentially regulated in response to denervation in mouse gastrocnemius muscle following sciatic nerve denervation . This finding suggests that Herpud2 may play a role in the molecular genetic events associated with neurogenic atrophy.

Quantitative PCR (qPCR) assessment of Herpud2 expression in muscle cells demonstrates that expression levels are lower in proliferating myoblasts compared to differentiated myotubes . This differential expression pattern indicates a potential role for Herpud2 in muscle differentiation processes. Western blot analysis has confirmed that Herpud2 is expressed in cultured muscle cells at the protein level .

The discovery of Herpud2's differential expression in response to neurogenic atrophy contributes to our understanding of the molecular mechanisms underlying muscle wasting, potentially leading to the identification of new therapeutic targets for the treatment and prevention of atrophy .

What role does Herpud2 play in endoplasmic reticulum-associated degradation (ERAD)?

Herpud2 serves as a critical component of the ERAD machinery, specifically within the HRD1-dependent pathway. As an integral component of the HRD1 complex, Herpud2 facilitates the retrotranslocation of misfolded proteins from the ER lumen to the cytosol for proteasomal degradation . This process is essential for maintaining ER homeostasis and preventing the accumulation of potentially toxic misfolded proteins.

The molecular mechanism involves Herpud2 acting as an adaptor between HRD1 (an E3 ubiquitin ligase) and DERL2 (a component of the retrotranslocation channel) . By recruiting DERL2 to HRD1, Herpud2 helps organize a functional retrotranslocation complex, enabling the efficient extraction of misfolded proteins from the ER membrane .

Research has demonstrated that Herpud2 is required, albeit semi-redundantly with Herpud1, for the degradation of specific ERAD substrates such as A1ATNHK . This indicates that while there is functional overlap between Herpud1 and Herpud2, each protein may have substrate specificity or condition-specific functions within the broader ERAD process.

How does Herpud2 interact with the HRD1 complex in retrotranslocation processes?

Herpud2 functions as an essential adaptor protein within the HRD1 complex, creating a crucial bridge between the E3 ubiquitin ligase HRD1 and the retrotranslocation channel component DERL2 . This interaction is fundamental to organizing a functional retrotranslocation complex in HRD1-mediated ERAD, facilitating the movement of misfolded proteins from the ER lumen to the cytosol.

The molecular architecture of this interaction involves Herpud2 specifically recruiting DERL2 to HRD1, establishing physical proximity between these components . This proximity is necessary for coordinated action during the retrotranslocation process, ensuring efficient substrate recognition, ubiquitination, and extraction from the ER membrane.

Studies have established that both Herpud1 and Herpud2 are integral components of the HRD1 complex . Their partial redundancy suggests evolutionary conservation of this critical function, with possible specialization for different subsets of ERAD substrates or varying cellular conditions. The degradation of specific substrates like A1ATNHK requires both proteins, indicating collaborative functionality in certain contexts .

What methodological approaches are recommended for CRISPR-Cas9 gene editing of Herpud2?

For effective CRISPR-Cas9 targeting of the Herpud2 gene, researchers should consider using guide RNA (gRNA) sequences specifically designed to minimize off-target effects while maintaining high efficiency. The laboratory of Feng Zhang at the Broad Institute has developed such sequences for targeting Herpud2 with minimal risk of off-target Cas9 binding elsewhere in the genome .

When implementing CRISPR-based approaches for Herpud2 study, it is recommended to order at least two gRNA constructs per gene to increase the chance of successful knockout . This redundancy helps overcome potential issues with individual gRNA effectiveness, which can vary depending on the specific genomic context and cell type.

For researchers targeting specific splice variants or exons of Herpud2, it is essential to double-check the gRNA sequences against the target gene sequence before ordering . The delivered plasmid should contain all elements required for gRNA expression and genome binding: the U6 promoter, spacer (target) sequence, gRNA scaffold, and terminator . Selection markers can facilitate the identification of successfully transfected cells.

How can researchers differentiate between the redundant functions of Herpud1 and Herpud2?

Distinguishing between the functions of Herpud1 and Herpud2 requires strategic experimental design due to their partial redundancy. A comprehensive approach involves performing individual and combinatorial knockdowns or knockouts followed by assessment of ERAD substrate degradation . This allows researchers to identify both unique and overlapping functions of these proteins.

Substrate-specific analyses can reveal differential dependencies on Herpud1 versus Herpud2. Studies of A1ATNHK degradation have shown that Herpud2 is required semi-redundantly with Herpud1 , suggesting substrate-specific contributions of each protein. Systematic testing of various ERAD substrates in cells with manipulated Herpud1 and Herpud2 levels can further illuminate their distinct functional profiles.

Tissue-specific and developmental expression profiling offers another avenue for functional differentiation. The distinctive expression pattern of Herpud2 in skeletal muscle during differentiation and in response to denervation may provide insights into specialized functions that differ from Herpud1. Comparative expression analysis across tissues and developmental stages could reveal context-specific roles for each protein.

What are the optimal protocols for expression and purification of recombinant rat Herpud2?

While specific protocols for rat Herpud2 expression and purification are not directly provided in the available data, approaches can be adapted from methodologies used for similar proteins. For rat proteins, expression systems incorporating affinity tags (such as His-tag) would facilitate subsequent purification steps, similar to approaches used for rat serum albumin protein .

The purification workflow should include affinity chromatography as the primary isolation step, followed by additional purification stages if necessary. Quality control should involve SDS-PAGE under reducing conditions to assess purity, with a target purity greater than 95% for research applications . Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can provide verification of the molecular weight and oligomeric state of the purified protein .

Functional validation of the recombinant Herpud2 should assess its ability to interact with known binding partners, particularly HRD1 and DERL2 . Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) techniques could be employed to quantify these interactions, similar to methodologies used for other protein-protein interaction analyses .

What strategies are most effective for cellular and biochemical studies of Herpud2 function?

For cellular studies of Herpud2 function, developing appropriate knockdown or knockout systems is essential. CRISPR-Cas9 gene editing offers a powerful approach for generating stable Herpud2 knockout cell lines, using guide RNA sequences specifically designed for the Herpud2 gene . For transient suppression, siRNA or shRNA approaches targeting Herpud2 mRNA provide alternatives with less permanent effects.

Biochemical analysis of Herpud2's role in ERAD can be conducted through co-immunoprecipitation assays to assess its interactions with other components of the ERAD machinery, particularly HRD1 and DERL2 . These assays can reveal the formation and stability of the retrotranslocation complex under various conditions, including ER stress or in the presence of specific ERAD substrates.

Functional assessment of Herpud2 activity typically involves monitoring the degradation of known ERAD substrates such as A1ATNHK . Pulse-chase experiments with radiolabeled substrates or fluorescently tagged reporters can quantify degradation kinetics in the presence or absence of Herpud2, revealing its contribution to ERAD efficiency.

How should researchers address the challenges of Herpud2 redundancy with Herpud1 in experimental design?

The partial functional redundancy between Herpud1 and Herpud2 presents significant challenges for experimental design. A comprehensive approach involves implementing both single and double knockdown/knockout strategies . This comparative methodology enables researchers to distinguish between unique functions and those that are shared between the two proteins.

Another strategy involves titrating expression levels of each protein to identify threshold effects or quantitative differences in their contributions to ERAD efficiency. This approach can reveal whether the two proteins function in a strictly redundant manner or if there are quantitative differences in their capabilities that become apparent at different expression levels.

What considerations are important when analyzing Herpud2 knockout phenotypes?

When analyzing Herpud2 knockout phenotypes, researchers must account for potential compensatory mechanisms, particularly the upregulation of Herpud1 or other ERAD components. This compensation may mask the true impact of Herpud2 loss, leading to underestimation of its importance in ERAD processes. Time-course analyses can help identify transient effects that occur before compensation is established.

Cell type-specific functions of Herpud2 should be considered when interpreting knockout phenotypes. The differential expression of Herpud2 in skeletal muscle cells at different stages of differentiation suggests that its role may vary across cell types and developmental stages. Therefore, knockout effects should be assessed in multiple cellular contexts and developmental timepoints.

Additionally, distinguishing between direct and indirect effects of Herpud2 knockout requires careful experimental controls. As a component of the ER quality control system, Herpud2 may influence multiple cellular processes beyond ERAD, including ER stress responses. Comprehensive analysis should include markers of these related pathways to differentiate primary effects from secondary consequences.

How can researchers quantitatively assess Herpud2 function in ERAD processes?

Quantitative assessment of Herpud2 function in ERAD processes requires robust assays that measure specific aspects of the pathway. Degradation kinetics of model ERAD substrates can be quantified using pulse-chase experiments or fluorescent reporter systems, comparing degradation rates between wild-type cells and those with Herpud2 manipulation.

The formation and stability of the HRD1-DERL2 complex can be assessed through quantitative co-immunoprecipitation followed by western blotting or mass spectrometry . This approach allows researchers to determine the efficiency of complex formation in the presence or absence of Herpud2, providing direct evidence of its adaptor function.

Advanced microscopy techniques, such as Förster resonance energy transfer (FRET) or fluorescence recovery after photobleaching (FRAP), can be employed to study the dynamics of Herpud2 interactions with other ERAD components in living cells. These approaches provide spatial and temporal information about Herpud2 function that complements biochemical analyses.

What are promising areas for advancing our understanding of Herpud2 in disease contexts?

The differential regulation of Herpud2 in response to neurogenic atrophy suggests potential roles in neuromuscular diseases and conditions associated with muscle wasting. Future research should explore the therapeutic potential of modulating Herpud2 expression or activity in models of muscular dystrophy, amyotrophic lateral sclerosis, or age-related sarcopenia.

The involvement of Herpud2 in ERAD processes indicates possible connections to diseases associated with protein misfolding and ER stress, such as neurodegenerative disorders and certain types of diabetes. Investigating Herpud2 expression and function in disease-relevant tissues and models could reveal novel pathological mechanisms and therapeutic opportunities.

Comparative studies of Herpud2 across species could provide evolutionary insights into the development of ERAD pathways and their adaptation to different physiological demands. Such studies might reveal species-specific functions or regulatory mechanisms that could inform our understanding of human disease processes and potential intervention strategies.

What technological advances could enhance research on Herpud2 function?

Development of specific antibodies or small molecule modulators of Herpud2 would significantly advance research capabilities. Currently, genetic approaches like CRISPR-Cas9 provide the primary means of manipulating Herpud2 function, but pharmacological tools would enable more precise temporal control and potentially therapeutic applications.

Advanced proteomics approaches, including proximity labeling techniques such as BioID or APEX, could reveal the complete interactome of Herpud2 beyond the currently known interactions with HRD1 and DERL2 . This comprehensive view would provide insights into additional functions and regulatory mechanisms affecting Herpud2 activity.

Single-cell analysis technologies applied to tissues with heterogeneous cell populations could reveal cell type-specific functions of Herpud2 that are obscured in bulk tissue analyses. This approach would be particularly valuable for understanding Herpud2's role in complex tissues like skeletal muscle, where its expression varies with differentiation state .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.