Recombinant Rat Hyaluronan synthase 2 (Has2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your location and purchase method. Please contact your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
Has2; Hyaluronan synthase 2; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Has2
Target Protein Sequence
MHCERFLCVLRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQ SLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVI DGNSDDDLYMMDIFSEVMGRDKSVTYIWKNNFHERGPGETEESHKESSQHVTQLVLSNKS ICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSVWFTILLGGVIFTIYKESKKPFSESKQTVLIVGTLIYACYWVVLLTLYVVLINKCGRR KKGQQYDMVLDV
Uniprot No.

Target Background

Function
Hyaluronan synthase 2 (Has2) catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. This enzyme plays a crucial role in hyaluronan synthesis, a major component of most extracellular matrices. Hyaluronan has structural functions in tissue architecture and regulates cell adhesion, migration, and differentiation. Has2 is one of the isozymes responsible for this process and is particularly involved in the synthesis of high molecular mass hyaluronan. It is essential for the transition of endocardial cushion cells into mesenchymal cells, a crucial step in heart development. Has2 may also play a role in vasculogenesis. High molecular mass hyaluronan also plays a role in early contact inhibition, a process that halts cell growth when cells come into contact with each other or the extracellular matrix.
Gene References Into Functions
  1. Hyaluronan biosynthesis, facilitated by HAS2, is necessary for the retention of aggrecan. PMID: 27094859
  2. Expression patterns of Has and Hyal genes vary between normal, acute-scarred, and chronic-scarred vocal folds, indicating the distinct roles of each enzyme in maintaining HA. PMID: 25499520
  3. Protein malnutrition primarily impacts the gene expression of Has2 and Has3, leading to reduced hyaluronan content and skin dysfunction. PMID: 12784612
  4. Epidermal hyaluronan synthesis, regulated by epidermal growth factor and transforming growth factor beta through changes in Has2 and Has3 expression, correlates with epidermal proliferation, thickness, and differentiation. PMID: 12787132
  5. Has2 gene is a potent primary EGF and all-trans-RA responding gene with a complex regulation. PMID: 15722343
  6. Leukemia inhibitory factor inhibits osteoblast development, at least in part, by stimulating high molecular weight hyaluronan synthesis through HAS2. PMID: 17451373
  7. Increased expression of Has2 and MMP-1 genes from BSCs may hold positive potential in the treatment of vocal fold scarring. PMID: 17989988
  8. Results provide evidence of HGF treatment effects on procollagen type III and HAS-2 gene expression pathways. PMID: 18834074
  9. HAS-1 expression was significantly decreased on rat vocal fold postinjury days 3, 7, 14, 28, and 56; HAS-2 expression was significantly decreased on postinjury days 28 and 56; HAS-3 expression was significantly decreased on postinjury day 56. PMID: 19393425

Show More

Hide All

Database Links
Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Hyaluronan Synthase 2 (Has2) and what is its biological significance?

Hyaluronan Synthase 2 (Has2) is a key enzyme that catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer, making it essential for hyaluronan synthesis . Hyaluronan is a major component of most extracellular matrices that plays crucial structural roles in tissue architecture and regulates cell adhesion, migration, and differentiation .

Has2 is particularly responsible for the synthesis of high molecular weight hyaluronan (HMW-HA) . Research has demonstrated that Has2 is required for the transition of endocardial cushion cells into mesenchymal cells, a process critical for heart development . Disruption of the Has2 gene in mice leads to embryonic lethality (E9.5-10) with severe cardiac and vascular abnormalities, highlighting its essential role in mammalian development .

The importance of Has2 extends beyond development to potential roles in longevity and cancer resistance, as evidenced by studies of the naked mole-rat Has2 gene (nmrHas2), which produces abundant HMW-HA associated with these beneficial traits .

How does naked mole-rat Has2 differ from rat Has2, and what are the implications of these differences?

Naked mole-rat Has2 (nmrHas2) differs from rat Has2 in several key aspects:

FeatureNaked Mole-Rat Has2Rat/Mouse Has2
Expression levelHigher expressionLower expression
HA productionProduces abundant HMW-HAProduces less HA with lower MW
Amino acid sequenceContains unique substitutions (especially at sites 178 and 301)Standard mammalian sequence
Associated hyaluronidase activityLower activity in tissuesHigher activity in tissues

The naked mole-rat Has2 gene contains specific amino acid substitutions that facilitate the production of HMW-HA . Particularly important are the substitutions at sites 178 and 301, which appear to be critical for HMW-HA production . The serine substitution at site 178 in naked mole-rats is shared only with the cane rat (a close outgroup to the Bathyergidae) .

These differences have significant implications for longevity and cancer resistance. When nmrHas2 was expressed in mice, it resulted in increased HA levels in multiple tissues, lower incidence of both spontaneous and induced cancer, extended lifespan, and improved healthspan .

What methodologies are effective for expressing and purifying recombinant rat Has2?

Successful expression of recombinant rat Has2 requires consideration of its membrane-bound nature and complex post-translational modifications. Based on experimental approaches documented in the literature:

  • Expression System Selection:

    • Mammalian expression systems (HEK293 cells) have been successfully used for Has2 expression, as demonstrated in studies where HEK cells transfected with plasmid encoding Has2 showed 6.5-9-fold higher HA concentrations in culture medium compared to controls .

    • Inducible expression systems are recommended to control Has2 activity, which can be cytotoxic at high levels.

  • Vector Design Considerations:

    • Use strong promoters like CAG or CMV for robust expression.

    • Consider adding epitope tags (His, FLAG) at non-critical domains for purification, while avoiding disruption of transmembrane domains.

    • For temporal control, Lox-STOP cassettes with Cre-ERT2 systems have been effective, as demonstrated in nmrHas2 transgenic mice .

  • Purification Strategy:

    • Membrane solubilization using detergents optimized for maintaining enzymatic activity.

    • Affinity chromatography using tagged constructs.

    • Size exclusion chromatography to separate active enzyme from aggregates.

  • Activity Verification:

    • Assess HA production by pulse-field gel electrophoresis to determine molecular weight distribution .

    • Use HA binding protein (HABP) staining to visualize HA production in transfected cells .

How can the enzymatic activity of recombinant rat Has2 be accurately measured and validated?

Multiple complementary approaches can be used to measure and validate Has2 enzymatic activity:

  • Quantification of HA Production:

    • ELISA-based assays for HA quantification in culture media.

    • Pulse-field gel electrophoresis to analyze molecular weight distribution of produced HA .

    • Radiometric assays measuring incorporation of radioactively labeled UDP-GlcUA or UDP-GlcNAc into HA polymers.

  • Visualization Techniques:

    • Hyaluronan binding protein (HABP) staining of cells or tissues to detect HA accumulation .

    • Fluorescently labeled HA precursors to track newly synthesized HA.

  • Functional Validation:

    • Hyaluronidase sensitivity assays: Treatment with hyaluronidase should degrade the produced HA, confirming its identity .

    • Molecular weight analysis: Has2-produced HA should primarily be high molecular weight (>1.5 MDa) .

  • Comparative Analysis:

    • Compare activity of wild-type versus mutant Has2 constructs.

    • Compare activity under different conditions (pH, temperature, ion concentrations) to establish optimal enzymatic parameters.

Research has shown that culture medium from cells transfected with Has2 expression plasmid contains high-molecular-weight HA larger than 1.5 MDa, which is no longer detectable after digestion with hyaluronidase .

What are the functional consequences of Has2 overexpression in different experimental models?

Has2 overexpression produces distinct phenotypes across different experimental models:

  • Cellular Models:

    • Increased HA production with predominantly large molecular weight HA in supernatant and low molecular weight HA in cell-associated fractions .

    • Enhanced cell migration, which can be abrogated by blocking antibodies to inter-alpha-inhibitor (IαI) or TNF-alpha-stimulated gene 6 (TSG-6) .

    • Increased expression of hyaluronidases .

    • Inhibition of HA cable formation with concurrent reduction in HA-dependent monocyte binding .

    • Increased pericellular HA matrix formation .

  • Transgenic Mouse Models:

    • nmrHas2 mice showed several significant phenotypic changes:

      • Lower spontaneous cancer incidence (57% vs 70% in controls) .

      • Further reduction in cancer incidence in older mice (>27 months): 49% vs 83% in controls .

      • Resistance to chemically induced skin tumorigenesis .

      • Extended median and maximum lifespan .

      • Improved healthspan with lower frailty scores and better physical performance .

      • Attenuated inflammation across multiple tissues .

      • Transcriptome signature shift toward longer-lived species .

  • Tissue-Specific Effects:

    • Renal tubular epithelial cells: Has2 overexpression affects cell migration through TSG-6-mediated formation of heavy chain-HA complexes .

    • Cardiac tissues: Has2 is essential for heart development, as knockout leads to severe cardiac abnormalities .

How does Has2-derived hyaluronan modulate inflammatory responses in research models?

Has2-derived high molecular weight hyaluronan (HMW-HA) demonstrates substantial anti-inflammatory effects through multiple mechanisms:

  • Direct Immunoregulatory Effects on Immune Cells:

    • Macrophages from nmrHas2 mice with elevated HMW-HA showed reduced inflammatory responses to LPS stimulation .

    • Reduced plasma TNFα levels (4 hours after LPS injection) were observed in nmrHas2 mice compared to controls .

    • Lower plasma IL6 levels were detected in both male and female nmrHas2 mice 4 hours after LPS treatment .

  • Tissue-Specific Anti-Inflammatory Effects:

    • Female nmrHas2 mice showed reduced inflammation in multiple tissues 24 hours after LPS injection:

      • Liver, spleen, and kidney had significantly lower pro-inflammatory IL1β and TNFα mRNA levels .

    • The most striking change in nmrHas2 mice was attenuated inflammation across multiple tissues during aging .

  • Molecular Mechanisms:

    • Transcriptomic analysis revealed that nmrHas2 expression was associated with:

      • Significant downregulation of pathways associated with interleukin and interferon signaling .

      • Upregulation of genes involved in oxidative phosphorylation, respiratory electron transport, and mitochondrial translation .

    • HMW-HA provides protection from oxidative stress .

    • HMW-HA improves gut barrier function during aging, potentially reducing systemic inflammation .

  • Comparison to Known Anti-Aging Interventions:

    • The anti-inflammatory gene expression profile in nmrHas2 mice showed similarities to known longevity interventions:

      • Positive association with patterns of maximum and median lifespan, caloric restriction, and rapamycin treatment .

      • Negative correlation with aging signatures .

    • Notably, nmrHas2 mice demonstrated stronger downregulation of inflammation and senescence than other examined longevity interventions .

What factors influence the molecular weight of hyaluronan produced by Has2?

The molecular weight of hyaluronan produced by Has2 is influenced by multiple factors:

  • Species-Specific Has2 Sequence Variations:

    • Naked mole-rat Has2 contains unique amino acid substitutions (particularly at sites 178 and 301) that facilitate production of higher molecular weight HA compared to other species .

    • The serine substitution at site 178 in naked mole-rats appears particularly important for HMW-HA production .

  • Hyaluronidase Activity:

    • The molecular weight of HA is significantly affected by the balance between synthesis (Has2) and degradation (hyaluronidases):

      • Naked mole-rat tissues show lower hyaluronidase activity compared to mouse tissues, contributing to HMW-HA accumulation .

      • Despite high nmrHas2 mRNA levels in mouse organs, only mild increases in HA were observed in transgenic mice, likely due to high hyaluronidase activity in mouse tissues .

      • Treatment with lipopolysaccharide (LPS) affects this balance by decreasing hyaluronidase expression, leading to accumulation of HMW-HA .

  • Cellular Compartmentalization:

    • Has2 overexpression increases HA generation, with different molecular weight profiles in different compartments:

      • Large molecular weight HA predominantly in the supernatant

      • Low molecular weight HA in cell-associated fractions

  • Post-Translational Modifications:

    • Phosphorylation states of Has2 can affect its activity and the resulting HA molecular weight.

    • The substitution of serine with alanine (as observed at site 177 in the cane rat and all bathyergids except the naked mole-rat) may affect phosphorylation and enzyme function .

  • Experimental Conditions:

    • UDP-sugar availability affects the processivity of Has2 and resulting HA length.

    • Culture conditions including pH, temperature, and ion concentrations influence enzymatic activity.

What are the current methodological approaches for studying Has2 gene function in development?

Several sophisticated methodological approaches are employed to study Has2 function during development:

  • Genetic Manipulation Techniques:

    • Knockout Models: Complete Has2 knockout in mice is embryonic lethal (E9.5-10), showing severe cardiac and vascular abnormalities . This approach revealed that Has2 is essential for the transformation of cardiac endothelial cells into mesenchyme .

    • Conditional Knockout: Using tissue-specific Cre-loxP systems to delete Has2 in specific tissues or at specific developmental timepoints.

    • Inducible Expression Systems: As demonstrated with nmrHas2 mice, using Lox-STOP cassettes with tamoxifen-inducible Cre recombinase (R26-CreERT2) allows for temporal control of Has2 expression .

  • Ex Vivo and Organ Culture Systems:

    • Heart Explant Cultures: Has2-/- heart explants lack the characteristic transformation of cardiac endothelial cells into mesenchyme, an essential developmental event .

    • Rescue Experiments: The defect in Has2-/- heart explants can be reversed by:

      • Gene rescue

      • Administering exogenous HA

      • Expressing activated Ras

  • Molecular Signaling Analysis:

    • Ras Signaling: The defect in Has2-/- heart explants is reproduced by expression of dominant-negative Ras in wild-type heart explants, revealing an HA-dependent pathway involving Ras activation .

    • Pathway Inhibition: Transformation in Has2-/- explants mediated by exogenous HA is inhibited by dominant-negative Ras, further confirming the relationship between HA and Ras signaling .

  • Visualization Techniques:

    • HABP Staining: Using hyaluronan binding protein to visualize HA distribution in tissues .

    • Pulse Field Gel Electrophoresis: To analyze the molecular weight and abundance of HA in different tissues .

How can researchers effectively control Has2 expression in experimental systems?

Effective control of Has2 expression is critical for studying its function. Several methodological approaches are available:

  • Inducible Expression Systems:

    • Tet-On/Tet-Off Systems: Allowing doxycycline-controlled expression.

    • Tamoxifen-Inducible Cre-ERT2 Systems: As used in nmrHas2 mice, where a Lox-STOP cassette preceding the nmrHas2 gene was removed upon tamoxifen administration to R26-CreERT2-expressing mice .

      • Protocol example: Tamoxifen injections at 3 months of age induced expression of the nmrHas2 gene in multiple tissues .

  • Viral Vector Delivery:

    • Adenoviral/Lentiviral Vectors: For transient or stable expression in specific tissues.

    • AAV-Based Systems: For long-term expression in non-dividing cells.

  • RNA Interference and Gene Editing:

    • siRNA/shRNA: For transient or stable knockdown of Has2.

      • siHAS2-LNP transfection has been shown to decrease Has2 expression in hepatic stellate cells .

    • CRISPR/Cas9: For precise editing of the Has2 gene or its regulatory elements.

  • Pharmacological Approaches:

    • 4-Methylumbelliferone (4MU): An inhibitor of HA synthesis that has been shown to significantly decrease Has2 mRNA levels .

    • Growth Factor Modulation: TGF-β activates Has2 expression in hepatic stellate cells, providing a mechanism to modulate Has2 activity .

  • Promoter Selection and Design:

    • Tissue-Specific Promoters: For targeted expression in specific cell types.

    • Ubiquitous Promoters: The CAG promoter was successfully used for widespread nmrHas2 expression in transgenic mice .

What are the advanced analytical techniques for characterizing Has2-produced hyaluronan in biological samples?

Comprehensive characterization of Has2-produced hyaluronan requires multiple analytical approaches:

  • Molecular Weight and Size Distribution Analysis:

    • Pulse-Field Gel Electrophoresis: Critical for separating high molecular weight HA species and determining size distribution . This technique showed that hyaluronan extracted from tissues of nmrHas2 mice was more abundant and had higher molecular weight in muscle, heart, kidney, and small intestine compared to controls .

    • Size Exclusion Chromatography: For precise fractionation of HA by molecular weight.

    • Multi-Angle Light Scattering: For absolute molecular weight determination without reference standards.

  • Structural and Compositional Analysis:

    • Nuclear Magnetic Resonance (NMR) Spectroscopy: For detailed structural characterization of HA and modifications.

    • Mass Spectrometry: For analysis of HA fragments and identification of modifications.

    • Hyaluronidase Digestion Assays: To confirm identity of HA and study resistance to enzymatic degradation .

  • Visualization and Localization:

    • Hyaluronan Binding Protein (HABP) Staining: For tissue localization of HA . This method showed stronger hyaluronan signal in muscle, kidney, and intestines of both male and female nmrHas2 mice compared to controls .

    • Super-Resolution Microscopy: For detailed visualization of HA distribution at the subcellular level.

    • Transmission Electron Microscopy: Combined with gold-labeled HABP for ultrastructural localization.

  • Functional Characterization:

    • Cell Adhesion and Migration Assays: To assess biological activity of produced HA.

    • Inflammatory Response Assays: Measuring cytokine production in response to different HA preparations (e.g., TNFα and IL6 levels after LPS stimulation) .

    • Receptor Binding Studies: Using labeled HA to study interactions with CD44, RHAMM, and other HA receptors.

  • Combined Approaches:

    • Correlation of HA Characteristics with Transcriptomic Data: As performed in nmrHas2 mice, revealing associations between HA abundance, inflammation reduction, and longevity-associated gene expression profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.