Recombinant Rat Hydroxycarboxylic acid receptor 2 (Hcar2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Rat Hcar2 is a laboratory-generated version of the endogenous hydroxycarboxylic acid receptor 2, designed for in vitro and in vivo studies. This receptor:

  • Binds ligands such as β-hydroxybutyrate and nicotinic acid (niacin), mediating anti-lipolytic and anti-inflammatory responses .

  • Couples with Gᵢ proteins to inhibit adenylyl cyclase, reducing intracellular cAMP levels and influencing pathways like neutrophil apoptosis and adiponectin secretion .

  • Plays roles in retinal angiogenesis, metabolic regulation, and inflammatory diseases .

Production and Expression Systems

Recombinant Rat Hcar2 is produced using multiple platforms:

  • E. coli: Cost-effective for large-scale production but limited to non-glycosylated forms .

  • Mammalian cells (e.g., HEK293): Ensures proper post-translational modifications and ligand-binding functionality .

  • In vitro systems: Used for functional assays and structural studies .

Table 2: Common Expression Systems

SystemAdvantagesLimitations
E. coliHigh yield, low costNo glycosylation
HEK293Native-like folding, glycosylationHigher cost, slower production

Metabolic Studies

  • Lipolysis Regulation: Recombinant Hcar2 is used to investigate niacin’s role in reducing free fatty acid release .

  • cAMP Signaling: Assays measure Gᵢ-mediated adenylyl cyclase inhibition .

Disease Models

  • Retinopathy: Studies in HCAR2-knockout mice show exacerbated pathological neovascularization, suggesting therapeutic targeting potential .

  • Inflammation: Ligand-activated Hcar2 inhibits VEGF-induced endothelial cell migration, relevant to diabetic retinopathy .

Table 3: Key Findings from HCAR2 Research

Study FocusFindingSource
Retinal AngiogenesisHCAR2 deletion increases VEGF expression
Ligand SelectivityMK-6892 binds an extended pocket in HCAR2
Self-ActivationECL2 acts as a built-in agonist

Pharmacological Relevance

  • Drug Design: Structural insights into ligand binding (e.g., niacin, acipimox) guide the development of HCAR2-targeted therapies for metabolic and inflammatory diseases .

  • Species Selectivity: Key residues (e.g., R111 in HCAR2 vs. Q174 in HCAR3) determine ligand specificity across species .

Future Directions

  • Structural Studies: Cryo-EM and molecular dynamics simulations to refine activation mechanisms .

  • Therapeutic Trials: Testing HCAR2 agonists in models of retinopathy, atherosclerosis, and neurodegenerative disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Hcar2; Gpr109; Gpr109a; Gpr109b; Niacr1; Pumag; Hydroxycarboxylic acid receptor 2; G-protein coupled receptor 109; G-protein coupled receptor 109A; G-protein coupled receptor HM74; Niacin receptor 1; Nicotinic acid receptor; Protein PUMA-G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR IFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAV DRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSIC YTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVIC FLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN FFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR
Uniprot No.

Target Background

Function
Recombinant Rat Hydroxycarboxylic acid receptor 2 (Hcar2) acts as a high-affinity receptor for both nicotinic acid (niacin) and (D)-β-hydroxybutyrate. It mediates increased adiponectin secretion and decreased lipolysis through Gi-protein-mediated inhibition of adenylyl cyclase. This pharmacological effect requires nicotinic acid doses significantly higher than those found in a typical diet. Hcar2 also mediates nicotinic acid-induced apoptosis in mature neutrophils. Nicotinic acid receptor activation reduces cAMP levels, potentially affecting cAMP-dependent protein kinase A activity and target protein phosphorylation, ultimately leading to neutrophil apoptosis. The relative potency for nicotinic acid binding displacement is: 5-methyl pyrazole-3-carboxylic acid = pyridine-3-acetic acid > acifran > 5-methyl nicotinic acid = acipimox >> nicotinuric acid = nicotinamide.
Gene References Into Functions
  1. GPR109a modulates niacin-induced pancreatic islet dysfunction by activating islet β-cells. PMID: 25622782
  2. HM74b, highly similar to HM74, is a receptor for nicotinic acid. PMID: 12646212
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in adipose tissue, lung and spleen.

Q&A

What is the molecular structure and cellular localization of rat Hcar2?

Rat Hydroxycarboxylic acid receptor 2 (Hcar2) is a G protein-coupled receptor (GPCR) encoded by the Hcar2 gene, which shares significant sequence homology with the human HCAR2 gene located on chromosome 12 at position 12q24.31 in humans . The protein consists of seven transmembrane domains characteristic of GPCRs and is predominantly expressed on the surface membrane of various cell types . In rats, as in humans, Hcar2 functions through G-protein signaling pathways, particularly through inhibitory G proteins (Gi) that reduce intracellular cyclic adenosine monophosphate (cAMP) levels upon receptor activation .

The receptor shows notable expression in immune cells including dendritic cells (DCs), macrophages, and microglia, as well as in intestinal epithelial cells (IECs) and other tissues . Within these cell types, Hcar2 is primarily localized to the plasma membrane where it can interact with its ligands, though some evidence suggests potential intracellular localization in certain contexts . Importantly, receptor expression can be dynamically regulated during inflammatory conditions and disease states, with studies showing significant upregulation in pathological conditions such as Alzheimer's disease models .

What are the primary endogenous and synthetic ligands for rat Hcar2?

Rat Hcar2, like its human counterpart, recognizes multiple endogenous and synthetic ligands with varying affinities and activation profiles. The primary endogenous ligands include D-β-hydroxybutyric acid and butyric acid, which are considered the physiological activators of Hcar2 under normal conditions . D-β-hydroxybutyric acid is particularly relevant as a ketone body that increases during fasting, caloric restriction, or ketogenic diets, potentially linking metabolic status to Hcar2-mediated functions . Butyric acid, a short-chain fatty acid produced by gut microbiota through fermentation of dietary fiber, represents another important endogenous activator, especially in the intestinal environment .

Niacin (nicotinic acid) serves as a high-affinity pharmaceutical ligand for Hcar2, though its endogenous levels are typically insufficient for receptor activation . When administered as a drug, niacin reaches concentrations capable of robust Hcar2 activation . Several synthetic derivatives have also been developed, including monomethyl fumarate (MMF), which is the active metabolite of dimethyl fumarate (DMF), a therapeutic used in multiple sclerosis . Importantly, researchers should note that these ligands may exhibit different potencies between rat and human Hcar2, necessitating careful consideration when translating findings between species .

How can I confirm successful expression of recombinant rat Hcar2 in cell culture models?

Confirming successful expression of recombinant rat Hcar2 in cell culture models requires a multi-faceted approach combining molecular and functional validation techniques. At the transcript level, reverse transcription polymerase chain reaction (RT-PCR) can be employed using specific primers targeting the rat Hcar2 sequence . Based on published literature, appropriate primers include forward primer: 5′-CTGCTCAGGCAGGATCATCT-3′ and reverse primer: 5′-CCCTCTTGATCTTGGCATGT-3′ . Quantitative PCR (qPCR) provides more precise quantification of expression levels when needed.

Protein expression can be confirmed through Western blotting using validated antibodies against Hcar2 . Published protocols suggest using anti-HCAR2 antibodies (such as Abcam, ab198693) at a 1:1000 dilution, followed by appropriate secondary antibodies and detection systems . Immunocytochemistry offers complementary validation, particularly for assessing subcellular localization of the receptor. Functional validation provides crucial confirmation of properly folded, membrane-inserted receptors and can be performed through ligand-binding assays or by measuring downstream signaling events such as changes in cAMP levels, calcium flux, or phosphorylation of target proteins like AMPK (using antibodies against P-AMPK Thr172) .

What are the best experimental models for studying rat Hcar2 function?

Several experimental models have been established for studying rat Hcar2 function, each offering distinct advantages depending on the research question. Cell culture systems using rat-derived cell lines that naturally express Hcar2 (such as primary microglia, dendritic cells, or macrophages) provide controlled environments for molecular mechanistic studies . Alternatively, heterologous expression systems where rat Hcar2 is transfected into cells like HEK293 or CHO cells allow for focused analysis of receptor pharmacology without the complexity of endogenous receptor expression .

Primary cell isolation protocols have been established for harvesting Hcar2-expressing cells from rat tissues, with detailed methodologies available for isolating dendritic cells, macrophages, and intestinal epithelial cells . For instance, intestinal epithelial cells can be isolated using collagenase treatment and mechanical disaggregation, followed by culture in specialized media containing growth factors such as EGF, Noggin, and R-spondin-1 . In vivo models include wild-type rats and, more commonly, mouse models including HCAR2 knockout mice, which have proven valuable for understanding physiological receptor functions . Importantly, comparison between wild-type and knockout models allows for specific attribution of observed effects to Hcar2 signaling .

How does rat Hcar2 signaling differ across various cell types?

Rat Hcar2 exhibits remarkable signaling diversity across different cell types, exemplifying its pleiotropic nature in physiological systems. In dendritic cells (DCs), Hcar2 activation triggers signaling pathways that promote an anti-inflammatory phenotype characterized by decreased production of interleukin-6 (IL-6) and increased expression of the immunosuppressive cytokine IL-10 . Additionally, Hcar2 activation in DCs upregulates retinaldehyde dehydrogenase 1 (RALDH1), the enzyme responsible for synthesizing retinoic acid, which subsequently promotes regulatory T cell (Treg) development—a critical mechanism for maintaining intestinal immune homeostasis .

In macrophages, Hcar2 signaling exerts anti-inflammatory effects through suppression of NF-κB activation and pro-inflammatory cytokine production, while also inhibiting chemokine-induced migration, thereby limiting inflammatory cell recruitment . The signaling mechanism involves pertussis toxin-sensitive G proteins, indicating the involvement of Gi proteins . Conversely, in intestinal epithelial cells, Hcar2 activation can trigger distinct pathways, with evidence suggesting potential activation of cyclooxygenase-2 (COX-2) pathways that might contribute to gastrointestinal side effects observed with some Hcar2 agonists like niacin and fumarates . In microglia, Hcar2 activation modulates neuroinflammatory responses, with genetic deletion experiments in mouse models demonstrating that Hcar2 deficiency impairs the microglial response to amyloid pathology in Alzheimer's disease models .

What experimental approaches are most effective for studying Hcar2-mediated immunomodulation?

Studying Hcar2-mediated immunomodulation requires sophisticated experimental approaches spanning molecular, cellular, and in vivo methodologies. Flow cytometry represents an essential technique for characterizing immune cell populations and their phenotypic changes following Hcar2 activation . Researchers can analyze expression of surface markers, intracellular cytokines, and transcription factors crucial for defining immune cell subtypes and their functional states . For example, studies have employed flow cytometry to quantify Foxp3+ regulatory T cells, IL-17-producing CD4+ T cells, and IL-10-producing CD4+ T cells in colonic lamina propria of wild-type versus Hcar2 knockout mice .

Ex vivo culture systems provide valuable platforms for investigating direct effects of Hcar2 agonists on immune cells . These systems allow for controlled exposure to ligands followed by comprehensive analysis of cellular responses through techniques like qPCR for cytokine gene expression, ELISA for secreted factors, and Western blotting for signaling pathway activation . Co-culture experiments, such as dendritic cell-T cell co-cultures, have been particularly informative in delineating how Hcar2-mediated changes in antigen-presenting cells influence T cell differentiation .

In vivo models of inflammation provide physiologically relevant contexts for studying Hcar2-mediated immunomodulation . The experimental autoimmune encephalomyelitis (EAE) model has been used to investigate Hcar2's role in neuroinflammation, with protocols involving immunization with myelin oligodendrocyte glycoprotein peptide 35-55 in appropriate adjuvants . Similarly, intestinal inflammation models have revealed Hcar2's protective functions in gut homeostasis . Notably, compound mutant models combining Hcar2 deficiency with other genetic manipulations (e.g., Hcar2-/- Rag1-/- mice) have uncovered interactions between Hcar2 signaling and other immune pathways .

What are the optimal methods for assessing Hcar2-mediated effects on intestinal homeostasis?

Assessing Hcar2-mediated effects on intestinal homeostasis requires multidisciplinary approaches spanning histological, immunological, and functional analyses. Histopathological examination remains fundamental, with protocols involving tissue fixation, sectioning, and staining with hematoxylin and eosin to evaluate morphological features such as epithelial integrity, crypt architecture, and inflammatory cell infiltration . More sophisticated imaging techniques like 3D X-ray phase contrast tomography have been employed to monitor intestinal alterations at morphological levels with higher resolution and detail .

Immunohistochemistry and immunofluorescence provide spatial information about the distribution of Hcar2-expressing cells and their relationship to other intestinal cell populations . These techniques have been crucial for characterizing the colonic lamina propria immune landscape in the context of Hcar2 expression or deficiency . Flow cytometric analysis of immune cells isolated from intestinal tissues offers quantitative assessment of various cell populations, including dendritic cells, macrophages, and different T cell subsets . This approach has revealed that Hcar2 deficiency leads to reduced Foxp3+/Treg cells and increased IL-17-producing CD4+ T cells in colonic lamina propria .

Functional assays for intestinal barrier integrity, such as in vivo permeability assays using fluorescently labeled dextrans, can provide insights into how Hcar2 signaling affects this critical aspect of intestinal homeostasis . Molecular analyses of intestinal tissues through qPCR and protein assays help quantify expression of inflammatory mediators, antimicrobial peptides, and mucins . Additionally, ex vivo culture systems using isolated intestinal epithelial cells treated with Hcar2 agonists allow for direct assessment of epithelial cell responses, including measurement of epithelial-derived factors that influence local immune responses .

What methodological approaches best characterize Hcar2's role in neuroinflammation and neurodegenerative conditions?

Characterizing Hcar2's role in neuroinflammation and neurodegenerative conditions requires specialized methodological approaches spanning molecular, cellular, and behavioral domains. Genetic models utilizing Hcar2 knockout mice crossed with neurodegenerative disease models (such as the 5xFAD Alzheimer's model) provide powerful tools for investigating Hcar2's functions in disease contexts . These models allow researchers to evaluate how Hcar2 deficiency affects disease progression, including pathological hallmarks and functional outcomes .

Immunohistochemical analyses of brain tissues from these models enable assessment of microglial responses, amyloid plaque burden, and neuronal pathology . Studies have demonstrated that genetic inactivation of Hcar2 in 5xFAD mice impairs the microglial response to amyloid pathology, exacerbates plaque burden, and worsens neuronal pathology . Flow cytometric characterization of brain-resident and infiltrating immune cells provides complementary quantitative data on neuroinflammatory processes . This approach can reveal changes in microglial phenotypes, activation states, and other neuroinflammatory markers associated with Hcar2 signaling .

Pharmacological studies using Hcar2 agonists like niacin or Niaspan (an FDA-approved extended-release formulation of niacin) allow for evaluation of therapeutic potential . These studies have shown that persistent activation of Hcar2 with Niaspan stimulates a protective response mediated by microglia in neurodegenerative models . Cognitive and behavioral testing provides functional readouts of neuroprotection, with evidence indicating that Hcar2 activation can mitigate cognitive impairment in Alzheimer's disease models . Combining these approaches with molecular analyses of inflammatory mediators, signaling pathways, and gene expression profiles yields comprehensive insights into Hcar2's mechanistic roles in neuroinflammatory processes .

How can contradictory findings regarding Hcar2 function be reconciled in experimental designs?

Reconciling contradictory findings regarding Hcar2 function requires careful consideration of experimental variables and implementation of robust study designs. One major source of contradiction stems from the pleiotropic nature of Hcar2 signaling across different cell types . Studies have shown that Hcar2 activation can trigger distinct, sometimes opposing, pathways in different cellular contexts . For example, while Hcar2 activation generally exerts anti-inflammatory effects in immune cells like macrophages and dendritic cells, it may activate pro-inflammatory pathways such as the cyclooxygenase-2 pathway in intestinal epithelial cells . Experimental designs should therefore include multiple cell types when evaluating Hcar2 function and avoid broad generalizations based on findings from a single cell type.

Another source of contradiction relates to ligand specificity and off-target effects . Many Hcar2 ligands, including β-hydroxybutyric acid, butyric acid, and niacin, have Hcar2-independent actions . For instance, β-hydroxybutyric acid activates free fatty acid receptor 3 and inhibits histone deacetylases, while niacin serves as an NAD+ precursor affecting numerous enzymatic reactions . Rigorous experimental designs should incorporate appropriate controls, including Hcar2 knockout models or specific receptor antagonists, to distinguish Hcar2-mediated effects from other actions of these ligands .

Temporal and contextual factors also contribute to contradictory findings . Hcar2's effects may differ depending on the inflammatory context, disease stage, or metabolic state . Alzheimer's disease studies have shown that Hcar2 expression changes dynamically during disease progression, potentially altering receptor function at different stages . Comprehensive experimental designs should therefore include time-course analyses and evaluations across different physiological or pathological contexts . Finally, species differences between rat and human Hcar2 could account for some contradictions in translational research, necessitating careful validation across species when extrapolating findings .

What are the optimal conditions for expressing and purifying recombinant rat Hcar2?

Expressing and purifying recombinant rat Hcar2 presents significant challenges due to its nature as a seven-transmembrane G protein-coupled receptor. Based on existing protocols for similar GPCRs, optimal expression can be achieved using eukaryotic expression systems rather than bacterial systems, as the former provide the cellular machinery necessary for proper protein folding and post-translational modifications . Mammalian cell lines such as HEK293 or CHO cells transfected with expression vectors containing the rat Hcar2 sequence have demonstrated successful expression . These vectors should ideally incorporate affinity tags (such as polyhistidine or FLAG tags) to facilitate downstream purification, preferably at the C-terminus to minimize interference with ligand binding at the N-terminus.

For membrane protein extraction, detergent-based methods using mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended to maintain protein structure and function . Solubilization buffers typically contain 1-2% detergent, 150-300 mM NaCl, 20-50 mM buffer (such as HEPES or Tris, pH 7.4-8.0), and protease inhibitors . Affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) resin for His-tagged proteins or anti-FLAG resin for FLAG-tagged proteins represents the primary purification step, followed by size exclusion chromatography to enhance purity .

Protein stability can be improved during purification by the addition of Hcar2 ligands such as niacin or β-hydroxybutyric acid to the buffers . Functional validation of the purified receptor through ligand-binding assays or reconstitution into proteoliposomes or nanodiscs for functional studies ensures that the purification process has preserved receptor activity . Throughout the process, Western blotting using validated anti-Hcar2 antibodies provides a means to monitor expression and purification efficiency .

What are the best techniques for measuring Hcar2 activation in different experimental systems?

Measuring Hcar2 activation requires specialized techniques tailored to the receptor's signaling mechanisms and the experimental system being used. As a Gi-coupled receptor, Hcar2 activation typically inhibits adenylyl cyclase, leading to decreased intracellular cAMP levels . Therefore, assays measuring cAMP represent direct readouts of receptor activation. Commercial cAMP assay kits based on enzyme immunoassays or HTRF (homogeneous time-resolved fluorescence) technologies offer sensitive quantification options . Alternatively, reporter cell lines expressing cAMP-responsive elements driving luciferase or fluorescent protein expression provide convenient visual readouts .

Downstream signaling events offer additional measurement possibilities. Western blotting for phosphorylated AMPK (P-AMPK Thr172) has been established as a reliable marker of Hcar2 activation in multiple cell types . Similarly, measuring phosphorylation of ERK1/2 (P-ERK1/2 Thr202/Tyr182) can indicate receptor activation in certain cellular contexts . More specific to inflammatory pathways, assessment of NF-κB p65 subunit phosphorylation (P-p65) or cyclooxygenase-2 (COX-2) expression provides insights into Hcar2's immunomodulatory effects .

For real-time kinetic measurements, fluorescence-based calcium assays may be employed in systems where Hcar2 couples to calcium signaling via Gβγ subunits . Label-free approaches such as dynamic mass redistribution or electrical impedance measurements offer holistic assessment of cellular responses to receptor activation without requiring genetic modification or labeling . In all cases, appropriate positive controls (known Hcar2 agonists like niacin) and negative controls (vehicle or Hcar2 antagonists) should be included, along with validation in Hcar2 knockout systems where possible .

How can receptor-ligand binding affinity be accurately determined for rat Hcar2?

Determining receptor-ligand binding affinity for rat Hcar2 requires specialized techniques adapted for membrane proteins. Radioligand binding assays remain the gold standard, typically using tritiated niacin ([3H]niacin) as the labeled ligand . These assays can be performed on membrane preparations from cells expressing recombinant rat Hcar2 or on intact cells . Saturation binding experiments, where increasing concentrations of the radioligand are used, allow determination of the equilibrium dissociation constant (Kd) and the maximum binding capacity (Bmax) . Competition binding assays, where unlabeled ligands compete with a fixed concentration of radioligand, enable determination of inhibition constants (Ki) for various ligands .

Alternative non-radioactive approaches include fluorescence-based binding assays using fluorescently labeled ligands or fluorescence polarization techniques . These methods offer advantages in terms of safety and throughput but may be less sensitive than radioligand approaches . Time-resolved fluorescence resonance energy transfer (TR-FRET) assays, where the receptor and ligand are labeled with donor and acceptor fluorophores, provide another sensitive option for measuring binding interactions .

Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) represent label-free biophysical methods for measuring binding affinities, though these typically require highly purified receptor preparations . For all binding assays, attention must be paid to buffer conditions, temperature, and incubation times to ensure equilibrium is reached . Validation across multiple methodologies and comparison with human HCAR2 binding properties can provide valuable insights into species differences that might impact translational research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.