Recombinant Rat Inhibitor of nuclear factor kappa-B kinase-interacting protein (Ikbip)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Inhibitor of Nuclear Factor Kappa-B Kinase-Interacting Protein (Ikbip)

Recombinant Rat Inhibitor of Nuclear Factor Kappa-B Kinase-Interacting Protein (Ikbip) is a protein that plays a crucial role in regulating immune responses and inflammation. It is part of the nuclear factor kappa-B (NF-κB) signaling pathway, which is vital for various cellular processes, including immune response, cell proliferation, and apoptosis. Ikbip functions by interacting with the NF-κB kinase subunits, thereby inhibiting their activity and modulating the downstream effects of NF-κB activation.

Research Findings on Ikbip

Recent studies have highlighted the importance of Ikbip in cancer biology and immunology:

Expression Patterns

Role as a Biomarker

Ikbip has emerged as a promising biomarker for cancer diagnosis and prognosis. It is linked to immune-related genes and pathways, suggesting its potential utility in immunotherapy strategies. For instance, higher levels of Ikbip expression have been correlated with increased immune cell infiltration in tumors .

Correlation with Immune Infiltration

Immune Cell TypeCorrelation with Ikbip Expression
CD8+ T CellsPositive
MacrophagesPositive
NeutrophilsNegative
Dendritic CellsPositive

Implications for Therapy

The role of Ikbip as an immune checkpoint inhibitor presents new avenues for therapeutic interventions in cancer treatment. Targeting Ikbip may enhance the efficacy of existing immunotherapies by modulating the tumor microenvironment and improving immune responses against tumors.

References

  1. Frontiers in Genetics, "I kappa B kinase interacting protein as a promising biomarker in pan-cancer" .

  2. National Center for Biotechnology Information (NCBI), Gene ID: 3551 .

  3. PMC Article on IKBIP's role in cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on the customer's requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
Ikbip; Ikip; Inhibitor of nuclear factor kappa-B kinase-interacting protein; I kappa-B kinase-interacting protein; IKBKB-interacting protein; IKK-interacting protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ikbip
Target Protein Sequence
MSEVKSRKKPGPKVAAPEPEKRSDGRKNPEARGGAGWADPRTGLSLLSLATSLGLAWLVF QQSEKFAKVENQYRLLQTESSEFQGLQSKISLISNKLESTENTLQEATSSMSLMTQFEQE VAGLQRSIHDIENSEEMLTQKLQNLNEKFQNITDLWKRTLVEMSDNTAVFKSEAKSTHSE VTLKINSAEQEIKLLTERLKDLEDSTLRNIRTVSRQEEEDLLRVEAQLSSDTKAVEKLEE EQRTLLARDEDLTDKLSSYEPKVEECKAHLPTIENAVHSVLRVSQDLIGTERKMEELTVQ MFNMEDDMLKAVSEIMEMQNTLEGIQYDNSLLKMQNELVVLKGKVHDFMAYSSAGEKGTL EEYNLENKGTDDY
Uniprot No.

Target Background

Function
Recombinant Rat Inhibitor of nuclear factor kappa-B kinase-interacting protein (Ikbip) targets p53/TP53 and exhibits pro-apoptotic function.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the Inhibitor of Nuclear Factor Kappa-B Kinase-Interacting Protein (Ikbip)?

Ikbip functions as a regulatory protein that interacts with components of the NF-κB signaling pathway, particularly the IκB kinase (IKK) complex. Similar to the better-characterized RKIP, Ikbip is believed to modulate IKK activity, thereby controlling NF-κB activation. RKIP has been shown to physically interact with multiple kinases in the NF-κB pathway, including NF-κB-inducing kinase, transforming growth factor beta-activated kinase 1, IKKα, and IKKβ . Through these interactions, Ikbip likely plays a role in regulating inflammatory responses, cell survival, and proliferation, which are all processes controlled by the NF-κB pathway. Understanding Ikbip's molecular structure and binding interfaces is essential for characterizing its regulatory function in cell signaling.

How does Ikbip differ from other NF-κB pathway regulators like RKIP?

While Ikbip shares functional similarities with RKIP, there are notable differences in their molecular structure and binding specificity. RKIP acts as a negative regulator of the MAPK cascade by disrupting the interaction between Raf-1 and MEK1, and it also antagonizes NF-κB activation by binding to upstream kinases in the pathway . Ikbip appears to have a more specific interaction with the IKK complex components. Studies have demonstrated that RKIP can physically interact with four kinases in the NF-κB activation pathway: NF-κB-inducing kinase, transforming growth factor beta-activated kinase 1, IKKα, and IKKβ . This multi-target binding capability may not be shared by Ikbip, which might have more selective binding partners within the IKK complex. The differential binding affinities and regulatory mechanisms between these proteins likely contribute to their non-redundant functions in controlling NF-κB signaling.

What are the known cellular functions of rat Ikbip?

Rat Ikbip is implicated in regulating the NF-κB signaling pathway, which is critical for multiple cellular functions. By interacting with components of the IKK complex (consisting of IKKα, IKKβ, and NEMO), Ikbip influences the activation of NF-κB transcription factors . This regulation affects numerous downstream processes including immune and inflammatory responses, cell survival, immune development, and cell proliferation . NF-κB signaling is activated by various stimuli including reactive oxygen intermediates, hypoxia/anoxia, hyperoxia, cytokines, and bacterial or viral products . In cardiac tissues, NF-κB plays a role in myocardial ischemia-reperfusion injury and ischemic preconditioning . By modulating NF-κB activation, Ikbip may influence the cell's response to these stimuli and affect pathological conditions associated with dysregulated NF-κB activity, such as chronic inflammatory diseases and certain cancers.

What experimental approaches are most effective for studying Ikbip's binding interactions with the IKK complex?

The most effective experimental approaches for studying Ikbip-IKK binding interactions incorporate a combination of biochemical, structural, and functional assays. Co-immunoprecipitation assays can identify physical interactions between Ikbip and IKK complex components, similar to how RKIP's interactions with NIK, TAK1, IKKα, and IKKβ were characterized . For more detailed binding analysis, in vitro binding assays using recombinant proteins can determine binding affinities and kinetics. Structural studies, including X-ray crystallography or cryo-electron microscopy, are essential for elucidating the three-dimensional interface between Ikbip and its binding partners. The NEMO-IKK interaction has been structurally characterized, revealing a binding "hotspot" that is rich in tryptophan, tyrosine, and arginine residues . Similar approaches could identify critical residues in Ikbip-IKK interactions.

Mutational analysis of predicted binding interfaces can validate structural findings and identify key residues required for protein-protein interactions. For example, the NBD peptide study demonstrated that replacing critical tryptophan residues with alanines (W739A and W741A) abolished binding to NEMO . Functional assays, such as NF-κB reporter assays, complement these approaches by assessing how Ikbip affects downstream signaling. Researchers have effectively used cell-penetrating peptides (CPPs) fused to inhibitory domains to disrupt protein interactions within cells, a strategy that could be applied to study Ikbip-IKK interactions in cellular contexts .

How can researchers effectively produce and purify recombinant rat Ikbip while maintaining its functional properties?

Producing functional recombinant rat Ikbip requires careful attention to expression systems, purification methods, and quality control. For mammalian expression, researchers can clone the Ikbip coding sequence into a single expression plasmid using efficient assembly methods similar to those used for recombinant antibody production . This approach involves amplifying the target gene, cloning it into a suitable expression vector, and transiently transfecting mammalian cells to ensure proper folding and post-translational modifications. A system using the FMDV 2A self-processing peptide has proven effective for producing full-length proteins from a single open reading frame .

For bacterial expression, the protein should be expressed with appropriate solubility-enhancing tags and under optimized induction conditions to prevent inclusion body formation. Purification typically involves affinity chromatography (using His or GST tags), followed by size exclusion and ion exchange chromatography to achieve high purity. Quality control measures should include SDS-PAGE analysis for purity assessment, mass spectrometry for protein identification, and circular dichroism for secondary structure verification. Functional validation is crucial and can include binding assays with known interaction partners from the IKK complex and in vitro kinase assays to assess the protein's ability to modulate IKK activity, similar to assays used for RKIP characterization . Western blotting with phospho-specific antibodies can monitor the impact on downstream signaling events such as IκB phosphorylation.

What are the challenges in developing specific antibodies against rat Ikbip, and how can they be addressed?

Developing specific antibodies against rat Ikbip presents several challenges that can be addressed using advanced immunization and screening strategies. One major challenge is the potential similarity between Ikbip and related proteins, which can lead to cross-reactivity. To address this, researchers can employ a high-throughput approach for generating and selecting recombinant rat monoclonal antibodies (RtmAbs) with high specificity . This process involves immunizing rats with cells expressing the target protein, followed by hybridoma generation and screening using high-throughput cell-based ELISA methods .

Another challenge is ensuring that antibodies recognize native Ikbip in its biologically relevant conformation. Using cells expressing Ikbip as immunogens rather than purified recombinant protein can help generate antibodies that recognize the protein in its native state . For screening, a cell-based ELISA approach can effectively identify antibodies that bind to the correctly folded protein . The hybridoma supernatants can be tested against cells expressing Ikbip to ensure specificity before proceeding to antibody cloning.

For cloning the selected antibodies, researchers can amplify the heavy and light variable regions from hybridoma cells and clone them into a single expression plasmid using an efficient assembly method . This allows for rapid production of full-length recombinant antibodies in mammalian cells. Validation of the antibodies should include testing for specificity (using Western blot, immunoprecipitation, and immunohistochemistry), affinity determination (using surface plasmon resonance), and functional characterization (assessing the antibody's ability to block Ikbip function) .

How does Ikbip regulate the classical vs. non-canonical NF-κB pathways?

Ikbip likely exerts differential effects on the classical and non-canonical NF-κB pathways through distinct interactions with pathway components. In the classical pathway, which depends on NEMO and IKKβ, Ikbip may regulate the formation and activity of the NEMO-IKKβ complex . Similar to how RKIP modulates this pathway, Ikbip might disrupt protein-protein interactions necessary for signal transduction or directly inhibit kinase activity . When the classical pathway is activated by stimuli like TNF-α or IL-1β, the IKK complex phosphorylates IκBα, leading to its degradation and subsequent NF-κB activation . Ikbip could interfere with this process at multiple levels.

In contrast, the non-canonical pathway relies primarily on IKKα and is independent of NEMO and IKKβ . Ikbip might have distinct interactions with IKKα that specifically regulate this pathway. Research on IKK complex regulation has revealed that the two pathways have different requirements: the classical pathway requires both NEMO and IKKβ, while the non-canonical pathway depends on IKKα alone . The differential affinities of inhibitory proteins for IKKα versus IKKβ can lead to pathway-specific effects. For instance, the NBD peptide shows different binding affinities for IKKα and IKKβ, indicating that targeting these interactions can have distinct effects on the two pathways . Researchers investigating Ikbip's regulatory role should design experiments that can distinguish between effects on classical versus non-canonical NF-κB signaling, potentially using pathway-specific stimuli and readouts.

What is the significance of Ikbip in NF-κB-mediated cardiac pathophysiology?

Ikbip likely plays a significant role in NF-κB-mediated cardiac pathophysiology by regulating inflammatory and stress responses in cardiac tissue. NF-κB activation has been implicated in various cardiac conditions, including myocardial ischemia-reperfusion injury, ischemic preconditioning, and unstable angina . In myocardial ischemia-reperfusion, NF-κB activation occurs shortly after the onset of ischemia and is further enhanced during reperfusion . This activation follows a biphasic pattern, with peaks at 15 minutes and 3 hours after reperfusion, corresponding to initial activation by reactive oxygen intermediates and subsequent activation by pro-inflammatory cytokines .

As a regulator of the IKK complex, Ikbip might influence this activation pattern and the resulting inflammatory response. Inhibition of NF-κB activity during reperfusion has been shown to reduce infarct size and improve cardiac function . For example, transfection with a decoy oligonucleotide containing the NF-κB binding site inhibited NF-κB activation during reperfusion and reduced infarct size in a rat model . Similarly, targeting NF-κB improved cardiac function and reduced neutrophil adherence in ex vivo perfusion models .

Researchers investigating Ikbip's role in cardiac pathophysiology should consider its potential impact on NF-κB-regulated genes involved in inflammation, leukocyte adhesion, and cytokine production, all of which contribute to reperfusion injury . Therapeutic approaches targeting Ikbip might provide a novel strategy for cardioprotection by modulating NF-κB activity in a tissue-specific manner.

How can researchers effectively use peptide inhibitors based on Ikbip to modulate NF-κB signaling?

Researchers can effectively use peptide inhibitors based on Ikbip by identifying critical binding interfaces and employing cell-penetrating peptide (CPP) technology for intracellular delivery. The first step is to identify the specific binding domain of Ikbip that interacts with IKK complex components, similar to how the NEMO binding domain (NBD) of IKKβ was characterized . This typically involves structural analysis and binding assays to pinpoint the minimal sequence required for binding. Once identified, researchers can synthesize peptides corresponding to this domain, which can competitively inhibit the interaction between Ikbip and its binding partners.

For cellular delivery of these inhibitory peptides, CPPs such as those derived from the Antennapedia protein (AntP) or HIV TAT protein can be fused to the Ikbip-derived peptide . This fusion enables the peptide to traverse cell membranes and reach intracellular targets. For example, an AntP-NBD fusion peptide effectively entered cells and blocked TNF- and IL-1-induced NF-κB activation . Alternative CPPs including TAT and synthetic variants like PTD-5 have also been successfully used to deliver inhibitory peptides .

To validate peptide function, researchers should employ NF-κB reporter assays, analyze downstream gene expression, and assess biological outcomes such as inflammation or cell survival. Control peptides with mutations in critical binding residues should be included to demonstrate specificity . For in vivo applications, researchers need to address pharmacokinetics, potential toxicity, and establish effective dosing regimens. Long-term, these peptide inhibitors may serve as templates for developing small molecule inhibitors or peptidomimetics with improved pharmacological properties .

What are the most reliable in vitro assays for evaluating Ikbip's effect on IKK activity?

The most reliable in vitro assays for evaluating Ikbip's effect on IKK activity combine biochemical kinase assays with protein-protein interaction studies and cellular signaling readouts. Reconstituted kinase assays using purified recombinant IKK complex components (IKKα, IKKβ, and NEMO) along with their substrates (such as IκBα) and recombinant Ikbip can directly measure how Ikbip affects phosphorylation activity. These assays typically involve incubating the kinases with substrate in the presence of ATP and measuring substrate phosphorylation using radioactive ATP incorporation or phospho-specific antibodies. Similar approaches have been used to show that RKIP antagonizes the activation of IKK activity elicited by TNF-α .

Protein-protein interaction assays, including surface plasmon resonance, isothermal titration calorimetry, and pull-down assays, can determine binding affinities between Ikbip and IKK complex components. These measurements help establish structure-function relationships and identify critical binding interfaces. For example, in vitro binding assays revealed that the NBD peptide could disrupt preformed IKK complexes by competing with and displacing IKKs from NEMO's hydrophobic binding pocket .

Cell-based assays using reporter systems (such as luciferase reporters driven by NF-κB response elements) can evaluate how Ikbip affects IKK-dependent NF-κB activation in a cellular context. Complementary approaches include measuring phosphorylation of endogenous IKK substrates by Western blotting and analyzing NF-κB-dependent gene expression by RT-PCR or RNA-seq. When RKIP's effect on NF-κB signaling was investigated, inhibition of endogenous RKIP by antibody microinjection activated an NF-κB reporter to approximately the same extent as ectopic expression of the p65 subunit of NF-κB .

How can researchers establish physiologically relevant animal models to study Ikbip function?

Establishing physiologically relevant animal models for studying Ikbip function requires careful genetic, pharmacological, and disease-specific approaches. Genetic models, including knockout and knockin rats, can be developed using CRISPR/Cas9 technology to completely eliminate Ikbip expression or introduce specific mutations that affect its function. Conditional knockouts using tissue-specific promoters (such as cardiac-specific promoters for studying Ikbip's role in heart disease) provide more refined control over where and when Ikbip is deleted, avoiding potential developmental effects of global deletion.

For pharmacological modulation, researchers can develop cell-penetrating peptides derived from Ikbip's binding domains, similar to the NBD peptide approach used to target the NEMO-IKK interaction . These peptides can be administered to animals to acutely disrupt Ikbip function in specific contexts. Disease-specific models should focus on conditions where NF-κB signaling plays a key role, such as myocardial ischemia-reperfusion injury models . In these models, coronary artery ligation followed by reperfusion induces NF-κB activation, and the contribution of Ikbip to this process can be assessed .

Validation of these models should include molecular characterization (confirming Ikbip deletion or inhibition), analysis of NF-κB pathway activity (measuring nuclear translocation of NF-κB subunits and expression of target genes), and assessment of relevant physiological parameters (such as infarct size or inflammatory responses in cardiac models) . For translational relevance, researchers should consider using heterotopic heart transplantation models, which have demonstrated the importance of NF-κB signaling in cardiac allograft rejection .

What high-throughput screening approaches can identify small molecule modulators of Ikbip function?

High-throughput screening for small molecule modulators of Ikbip function can employ multiple complementary approaches focused on protein-protein interactions and functional outcomes. Fluorescence-based protein-protein interaction assays, such as fluorescence resonance energy transfer (FRET) or fluorescence polarization, can screen compounds that disrupt the binding between Ikbip and IKK complex components. In these assays, Ikbip and its binding partner are labeled with appropriate fluorophores, and compounds that disrupt their interaction cause measurable changes in fluorescence properties. This approach has been used successfully to identify inhibitors of other protein-protein interactions in the NF-κB pathway .

Cell-based reporter assays using luciferase or fluorescent proteins under the control of NF-κB response elements can screen for compounds that affect Ikbip-mediated regulation of NF-κB activity. These assays can be adapted to 384- or 1536-well formats for high-throughput screening. For even higher throughput, researchers can develop multiplexed assays that simultaneously measure NF-κB activity and cell viability to identify selective modulators without cytotoxicity.

Structure-based virtual screening can complement these approaches by using computational methods to identify compounds predicted to bind to critical interfaces in Ikbip. This requires structural information about Ikbip and its binding partners, which can be obtained through X-ray crystallography or homology modeling based on related proteins like RKIP. Biochemical validation of hit compounds should include dose-response studies, binding affinity measurements, and selectivity profiling against related pathways. Cellular validation should assess effects on endogenous NF-κB signaling, using Western blotting for IκB phosphorylation and degradation, NF-κB nuclear translocation, and target gene expression .

How should researchers interpret contradictory data on Ikbip's role in different cellular contexts?

When faced with contradictory data regarding Ikbip's role across different cellular contexts, researchers should systematically analyze experimental variables and consider context-dependent regulatory mechanisms. First, examine cell type-specific factors that might influence Ikbip function, including the expression levels of interacting partners, post-translational modifications, and the presence of competing regulators. The NF-κB pathway is known to be regulated differently across cell types, with tissue-specific factors influencing activation and response .

Stimulus-specific effects should also be considered, as NF-κB can be activated by various stimuli including reactive oxygen intermediates, hypoxia/anoxia, cytokines, and bacterial or viral products . Each stimulus may engage different upstream pathways that could interact differently with Ikbip. For example, RKIP has been shown to modulate both TNF-α and IL-1β-mediated signaling, though the mechanisms may differ slightly .

Temporal dynamics are crucial for interpreting contradictory data, as NF-κB activation can be biphasic or oscillatory. In myocardial ischemia-reperfusion, NF-κB activation peaks at 15 minutes and again at 3 hours after reperfusion . Ikbip might have different effects during these distinct phases. Additionally, consider that Ikbip may have dual functions depending on its interaction partners or post-translational modifications, similar to how many signaling proteins can act as both positive and negative regulators under different conditions.

To resolve contradictions, design experiments that directly compare Ikbip function across multiple cell types under identical conditions, use multiple complementary assays to measure the same endpoint, and perform time-course experiments to capture the full dynamics of Ikbip's effects. Genetic approaches, such as CRISPR/Cas9-mediated gene editing, can provide clearer answers by eliminating Ikbip expression completely rather than relying solely on overexpression or inhibition approaches.

What are the common pitfalls in analyzing Ikbip's effects on NF-κB signaling, and how can they be avoided?

Several common pitfalls in analyzing Ikbip's effects on NF-κB signaling can be avoided through careful experimental design and controls. One major pitfall is overlooking the distinction between the classical and non-canonical NF-κB pathways, which involve different components and kinetics . Researchers should use pathway-specific stimuli and readouts to distinguish Ikbip's effects on these distinct mechanisms. For the classical pathway, TNF-α or IL-1β stimulation and IκBα phosphorylation/degradation are appropriate markers, while for the non-canonical pathway, factors like lymphotoxin-β and p100 processing should be monitored .

Another common pitfall is relying solely on overexpression studies, which may not reflect physiological regulation. Overexpressed proteins can form non-specific interactions or disrupt cellular stoichiometry, leading to artifacts. To avoid this, complement overexpression with loss-of-function approaches such as siRNA knockdown or CRISPR/Cas9 knockout. Additionally, use physiologically relevant expression levels when possible, and validate key findings using endogenous proteins.

Timing is critical when studying NF-κB signaling, as the pathway exhibits complex temporal dynamics. Single time-point measurements can miss important regulatory events or lead to inconsistent results across experiments. Perform detailed time-course analyses to capture the full dynamics of NF-κB activation and Ikbip's regulatory effects . Similarly, cell-specific effects can complicate data interpretation. The same regulatory mechanism may have different outcomes in different cell types due to varying expression of pathway components. Use multiple cell lines relevant to your research question and validate key findings in primary cells when possible.

Finally, avoid relying solely on artificial reporter systems, which may not accurately reflect endogenous signaling. Validate reporter assay results by measuring endogenous NF-κB target gene expression and protein-level changes in pathway components.

How can researchers troubleshoot issues with recombinant Ikbip expression and purification?

Troubleshooting recombinant Ikbip expression and purification requires a systematic approach to identify and address specific issues at each step of the process. For poor expression yields, consider optimizing codon usage for the expression host, as codon bias can significantly affect protein production. Try different expression systems (bacterial, insect, or mammalian cells) to find the most suitable host for Ikbip expression. If using bacterial systems, test multiple strains, including those designed for expression of difficult proteins such as Rosetta or Origami strains. Vary induction conditions including temperature, inducer concentration, and induction time to improve soluble protein yield.

To address protein insolubility and inclusion body formation, lower the expression temperature (16-20°C) to slow protein synthesis and facilitate proper folding. Co-express Ikbip with chaperones to assist folding, or use solubility-enhancing fusion tags such as MBP, SUMO, or GST. If inclusion bodies persist, develop a refolding protocol using gradual dilution or dialysis methods to recover active protein.

For purification issues, test multiple affinity tags and positions (N-terminal vs. C-terminal) to identify the optimal configuration that doesn't interfere with Ikbip folding. Optimize buffer conditions by varying pH, salt concentration, and additives to improve protein stability and reduce aggregation. Consider adding reducing agents if Ikbip contains cysteines that might form inappropriate disulfide bonds. If conventional purification fails, explore alternative approaches such as ion exchange chromatography based on Ikbip's theoretical isoelectric point or hydrophobic interaction chromatography.

To verify protein functionality after purification, perform binding assays with known interaction partners from the IKK complex, similar to those used for RKIP characterization . Conduct activity assays to confirm that the recombinant Ikbip can modulate IKK activity in vitro. Assess protein folding using circular dichroism or thermal shift assays to ensure the purified protein has the correct secondary structure. Finally, optimize storage conditions (buffer composition, pH, glycerol percentage, and temperature) to maintain long-term stability of the purified protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.