Recombinant Rat Insulin-induced gene 2 protein (Insig2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Lipid Metabolism and Disease

Insig2 binds to SREBP cleavage-activating protein (SCAP) in a sterol-dependent manner, retaining the SCAP-SREBP complex in the ER and preventing SREBP processing in the Golgi apparatus . This mechanism suppresses lipogenesis and cholesterol synthesis.

Table 1: Key Functional Insights from Experimental Studies

Study ModelFindingsReference
Obese Zucker diabetic ratsHepatic overexpression of Insig2 reduced nuclear SREBP-1c levels and plasma triglycerides by 50% .
Buffalo mammary cellsInsig2 knockdown increased triacylglycerol (TAG) content and upregulated lipogenic genes (e.g., FASN, SCD) .
Normal refed ratsInsig2 overexpression blunted the post-fasting rebound of SREBP-1c and its target enzymes .

Research Applications of Recombinant Rat Insig2

Recombinant Insig2 is widely used to investigate metabolic disorders, including obesity, hepatic steatosis, and insulin resistance.

Key applications include:

  1. Mechanistic studies: Elucidating how Insig2 modulates SREBP-dependent lipogenesis in vivo .

  2. Therapeutic exploration: Testing gene therapy approaches (e.g., adenoviral delivery) to counteract hyperlipidemia .

  3. Cell culture models: Lentiviral overexpression/knockdown in mammary epithelial cells to study milk fat synthesis .

Production and Purification Protocols

The recombinant protein is typically produced in E. coli systems. A standardized protocol involves:

  1. Cloning: Full-length Insig2 cDNA (e.g., GenBank accession Q80UA9) into prokaryotic expression vectors .

  2. Induction: IPTG-induced expression in BL21(DE3) E. coli strains .

  3. Purification: Immobilized metal affinity chromatography (IMAC) using His-tag systems .

Clinical and Agricultural Relevance

  • Obesity and diabetes: Insig2 overexpression in rodent models reduces hepatic lipid accumulation, suggesting therapeutic potential .

  • Dairy science: Low Insig2 levels during lactation correlate with increased milk fat synthesis in buffalo, highlighting agricultural applications .

References

  1. Characterization of the human INSIG2 promoter and its role in lipid metabolism .

  2. Hepatic Insig2 overexpression reduces lipogenesis in obese Zucker rats .

  3. INSIG2 negatively regulates milk fat synthesis in buffalo mammary cells .

  4. Recombinant Insig2 production and specifications .

  5. Role of Insig2 in SREBP processing and metabolic disease .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Insig2; Insulin-induced gene 2 protein; INSIG-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Insig2
Target Protein Sequence
MAEGETESPRPKKRGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVITSIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH ASAKVDFDNNFQFSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Uniprot No.

Target Background

Function
Insulin-induced gene 2 (Insig2) is an oxysterol-binding protein that plays a critical role in regulating cholesterol synthesis through a feedback mechanism. It exerts its control by influencing both the endoplasmic reticulum (ER) to Golgi transport of SREBP cleavage-activating protein (SCAP) and the degradation of 3-hydroxy-3-methylglutaryl-CoA reductase (HMGCR). Insig2 acts as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex within the ER, thus preventing the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2. It specifically binds oxysterols, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol, thereby modulating its interaction with SCAP and the retention of the SCAP-SREBP complex in the ER. In the presence of oxysterols, Insig2 interacts with SCAP, retaining the SCAP-SREBP complex in the ER, thereby preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi apparatus. Conversely, sterol deprivation or phosphorylation by PCK1 reduces oxysterol-binding, disrupting the interaction between Insig2 and SCAP, thereby promoting Golgi transport of the SCAP-SREBP complex, followed by the processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2. Insig2 also regulates cholesterol synthesis by influencing the degradation of HMGCR. It initiates the sterol-mediated ubiquitin-mediated ER-associated degradation (ERAD) of HMGCR by recruiting the reductase to the ubiquitin ligase RNF139.
Gene References Into Functions
  1. Liver-specific mRNA for Insig-2 down-regulated by insulin: implications for fatty acid synthesis. PMID: 12624180
Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Insig2 in lipid metabolism?

Insig2 functions as a negative regulator of lipid synthesis in mammalian cells by controlling the proteolytic activation of sterol regulatory element-binding proteins (SREBPs). Located within the endoplasmic reticulum (ER), Insig2 prevents the transport of SREBPs from the ER to the Golgi, where they would normally undergo proteolytic processing to release their transcription-activating domains . This inhibition of SREBP processing effectively suppresses the expression of lipogenic enzymes and reduces triglyceride accumulation in tissues.

The antilipogenic activity of Insig2 has been demonstrated through overexpression studies that show reduced nuclear SREBP-1c levels and diminished expression of SREBP-1c target enzymes . This mechanism represents a crucial checkpoint in the regulation of de novo fatty acid synthesis and cholesterol production, making Insig2 an important molecular target in metabolic research.

How does Insig2 differ from Insig1?

While Insig1 and Insig2 are homologous ER proteins that both regulate SREBP processing, they exhibit several critical functional differences that support their distinct physiological roles. A key structural difference is that Insig2 contains a serine residue at position 106 that can be phosphorylated by protein kinase A (PKA), whereas Insig1 lacks this phosphorylation site . This unique feature of Insig2 enables it to respond to signaling by polyunsaturated fatty acids like eicosapentaenoic acid (EPA), which activates adenylate cyclase and subsequently PKA.

The phosphorylation of Insig2 at serine-106 selectively inhibits the processing of SREBP-1 (controlling fatty acid synthesis) without affecting SREBP-2 (regulating cholesterol synthesis) . This selective inhibition represents a specialized regulatory mechanism that allows for differential control of lipid metabolism pathways, a function that Insig1 cannot perform due to its structural limitations.

What transcriptional variants of Insig2 exist in rodents?

In rodents, two distinct Insig2 transcripts have been identified: Insig2a and Insig2b. These variants arise from the use of different promoters that generate alternative non-coding first exons, which then splice into a common second exon . The Insig2a transcript is liver-specific and subject to negative regulation by insulin, while Insig2b is expressed ubiquitously across tissues .

This differential expression pattern suggests tissue-specific roles for Insig2 variants. Notably, comparative genomic analysis reveals high sequence conservation between rodent and human Insig2 genes, although only the Insig2b transcript has been detected in human liver, suggesting species-specific regulatory mechanisms . Understanding these transcript variants is essential for designing appropriate experimental systems when studying Insig2 function across species.

How can Insig2 be effectively overexpressed in cellular models?

For successful overexpression of Insig2 in cellular models, recombinant adenoviral vectors have proven highly effective, particularly for studies in primary cells like hepatocytes. The methodology typically involves constructing adenoviral vectors containing the Insig2 cDNA under control of a strong promoter such as the cytomegalovirus (CMV) promoter . This approach achieves robust protein expression with high transduction efficiency.

For in vitro studies with established cell lines, lentiviral transfection systems can provide stable long-term expression of Insig2. As demonstrated in buffalo mammary epithelial cells (BuMECs), lentiviral delivery of Insig2 expression constructs enables researchers to evaluate the effects of sustained Insig2 overexpression on lipogenic gene expression and triglyceride accumulation . When designing overexpression experiments, researchers should consider including appropriate controls such as empty vector or β-galactosidase expressing vectors to account for non-specific effects of viral transduction.

What techniques are most effective for measuring Insig2 phosphorylation?

Detection of Insig2 phosphorylation, particularly at the critical serine-106 residue, requires specialized immunological approaches. The most effective methodology involves immunoprecipitation followed by Western blotting with phospho-specific antibodies. Researchers have successfully employed polyclonal rabbit antibodies raised against a synthetic peptide containing phosphorylated serine-106 of Insig2 .

The experimental procedure involves treating cells with compounds that activate the cAMP-PKA pathway (such as 8-Bromo-cAMP or EPA), followed by cell lysis under conditions that preserve protein phosphorylation (including phosphatase inhibitors). After immunoprecipitation of Insig2 using general anti-Insig2 antibodies, the immunoprecipitates are separated by SDS-PAGE and probed with the phospho-specific antibody . Quantification can be achieved using LI-COR imaging systems, which provide precise measurements of phosphorylated versus total Insig2 protein. Confirmation of antibody specificity should include parallel analysis of serine-to-alanine mutants (S106A) as negative controls.

How can researchers effectively knockdown Insig2 expression?

RNA interference (RNAi) technologies provide powerful approaches for Insig2 knockdown in experimental systems. Lentiviral delivery of short hairpin RNA (shRNA) targeting specific regions of the Insig2 mRNA has been effectively employed in BuMECs to reduce Insig2 expression levels . When designing knockdown experiments, researchers should target regions unique to Insig2 to avoid off-target effects on Insig1 or other related genes.

The experimental protocol typically involves transducing cells with lentiviral particles containing the shRNA construct, followed by selection of stably transduced cells using appropriate antibiotic markers. Validation of knockdown efficiency should be performed at both mRNA level (using quantitative RT-PCR) and protein level (using Western blotting) . To establish causality in observed phenotypes, rescue experiments involving re-expression of shRNA-resistant Insig2 constructs can provide compelling evidence for Insig2-specific effects.

How does Insig2 regulate milk fat synthesis in mammary epithelial cells?

Insig2 exerts significant negative regulatory effects on milk fat synthesis in mammary epithelial cells through coordinated suppression of key lipogenic pathways. In buffalo mammary epithelial cells (BuMECs), experimental manipulation of Insig2 expression revealed its central role in controlling triacylglycerol (TAG) production. Overexpression of Insig2 induced comprehensive down-regulation of critical lipogenic transcription factors and enzymes, including SREBP, PPARG, FASN, ELOVL6, SCD, APGAT6, and TIP47, resulting in significantly decreased TAG content .

Conversely, knockdown of Insig2 led to increased TAG production accompanied by upregulation of the same lipogenic factors, confirming Insig2's inhibitory function . Physiologically, this regulatory mechanism appears developmentally controlled, as protein abundance of Insig2 was found to be higher during the dry-off period compared to peak lactation in buffalo mammary tissue . This temporal regulation suggests Insig2 contributes to the cessation of milk fat production during mammary involution, demonstrating its relevance to mammary gland biology and lactation research.

What is the mechanism by which phosphorylated Insig2 selectively inhibits SREBP-1 processing?

The selective inhibition of SREBP-1 processing by phosphorylated Insig2 represents a sophisticated regulatory mechanism in fatty acid metabolism. Upon phosphorylation at serine-106 by protein kinase A (PKA), Insig2 undergoes conformational changes that enhance its ability to retain SREBP-1 in the endoplasmic reticulum, preventing its transport to the Golgi where proteolytic processing would normally occur . This phosphorylation-dependent regulation creates an elegant system for selectively controlling fatty acid synthesis while maintaining cholesterol synthesis.

Experimental evidence for this selective mechanism comes from studies showing that EPA-induced inhibition of SREBP-1 processing was significantly reduced when serine-106 in Insig2 was replaced with alanine (S106A) or when cells were treated with KT5720, a PKA inhibitor . The ratio of nuclear to precursor SREBP-1 (N/P ratio) was reduced by 72% in cells expressing wild-type Insig2 when treated with EPA, but only by 20% in cells expressing the S106A mutant . Interestingly, this phosphorylation-dependent mechanism does not affect SREBP-2 processing, allowing cholesterol synthesis to continue even when fatty acid synthesis is inhibited.

How does hepatic Insig2 overexpression affect lipid metabolism in obese animal models?

Hepatic overexpression of Insig2 in obese animal models produces substantial therapeutic effects on lipid metabolism. In Zucker diabetic fatty (ZDF) (fa/fa) rats, adenoviral-mediated overexpression of Insig2 significantly attenuated the development of hepatic steatosis and hyperlipidemia that typically characterizes these animals . This intervention reduced the elevated levels of nuclear SREBP-1c, the activated form of the transcription factor that drives lipogenic gene expression in the liver.

The molecular mechanism underlying these improvements involves Insig2-mediated retention of SREBP-1c in the endoplasmic reticulum, preventing its proteolytic activation and thereby reducing the expression of its lipogenic target enzymes . This experimental approach not only demonstrates the potential therapeutic value of targeting Insig2 in metabolic disorders but also provides a mechanistic understanding of how Insig2 functions in the context of insulin resistance and obesity, where aberrant SREBP-1c activation contributes to pathological lipid accumulation.

How is Insig2 gene expression regulated at the transcriptional level?

Transcriptional regulation of the Insig2 gene involves complex interactions between specific promoter elements and transcription factors. Detailed characterization of the human INSIG2 promoter has identified a crucial 350-bp region upstream of the transcription start site that contains functional regulatory elements . Within this region, an Ets-consensus motif in the proximal promoter plays a particularly important role in transcriptional activation.

The Ets family member SAP1a (serum response factor accessory protein-1a) has been demonstrated to interact with this promoter region through chromatin immunoprecipitation assays and electrophoretic mobility shift assays . This interaction is functionally significant, as mutation of the Ets-binding site dramatically reduces INSIG2 promoter activity. Additionally, insulin stimulation activates the human INSIG2 promoter through a process involving phosphorylated SAP1a , revealing an unexpected regulatory mechanism given that insulin generally promotes lipid synthesis while Insig2 inhibits it.

What is the role of polyunsaturated fatty acids in regulating Insig2 function?

Polyunsaturated fatty acids (PUFAs), particularly eicosapentaenoic acid (EPA), regulate lipid metabolism in part through modulation of Insig2 function. EPA inhibits fatty acid synthesis by activating adenylate cyclase, which increases cellular cyclic AMP (cAMP) levels and subsequently activates protein kinase A (PKA) . Activated PKA phosphorylates Insig2 at serine-106, enhancing its ability to block SREBP-1 processing and thereby inhibiting fatty acid synthesis.

The level of phosphorylated Insig2 increases proportionally with EPA concentration, with 3.5-, 9.6-, and 12.5-fold increases observed at EPA concentrations of 1, 3, and 10 μM, respectively . This dose-dependent response provides a molecular mechanism for the well-established observation that PUFAs suppress fatty acid synthesis. Importantly, this effect is specific to Insig2, as Insig1 lacks the serine-106 phosphorylation site and is therefore not regulated by this mechanism.

How do Insig2 transcripts differ in their response to insulin signaling?

The response of Insig2 transcripts to insulin signaling exhibits both species-specific and transcript-specific patterns. In rodents, two distinct Insig2 transcripts have been identified: Insig2a, which is liver-specific, and Insig2b, which is expressed ubiquitously . The Insig2a transcript is down-regulated by insulin, creating a mechanism whereby insulin increases SREBP1c processing in liver by reducing Insig2a levels.

What are the methodological challenges in studying species-specific differences in Insig2 function?

Investigating species-specific differences in Insig2 function presents several methodological challenges. The primary challenge stems from the differential expression of Insig2 transcript variants between species. While rodents express both Insig2a and Insig2b transcripts in liver, humans express only the Insig2b variant . This fundamental difference necessitates careful experimental design when translating findings between animal models and human systems.

Researchers must employ species-specific primers for RT-PCR analysis to accurately detect the relevant transcripts. For example, comparative analysis of human and rodent genomic sequences revealed high sequence homology that allowed for the design of specific primers to assess Insig2a and Insig2b expression across species . Additionally, when using cell culture models, researchers should be aware that human HEK293T and HepG2 cells express only the Insig2b transcript, which impacts how these models represent in vivo regulation. Addressing these challenges requires rigorous validation of experimental systems and careful interpretation of results when making cross-species comparisons.

How can contradictions in Insig2 regulation data be reconciled across different experimental systems?

Reconciling contradictory data regarding Insig2 regulation across experimental systems requires systematic consideration of several variables. One significant contradiction relates to insulin's effect on Insig2 expression. While insulin reportedly down-regulates the rodent Insig2a transcript , creating a permissive environment for SREBP1c processing, research on the human INSIG2 promoter suggests that insulin can activate INSIG2 expression through phosphorylated SAP1a .

This apparent contradiction may be resolved by recognizing the transcript-specific and context-dependent nature of insulin regulation. The divergent effects could reflect differential regulation of specific promoters controlling Insig2a versus Insig2b transcription. To address such contradictions, researchers should employ multiple complementary approaches, including:

  • Parallel analysis of endogenous transcript levels and promoter activity

  • Precise delineation of the specific transcript variants being studied

  • Comparison of results across different cell types and physiological conditions

  • Consideration of the temporal dynamics of insulin signaling

By systematically addressing these factors, researchers can develop more nuanced models of Insig2 regulation that accommodate seemingly contradictory observations across different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.