Recombinant Rat Integrin beta-4 (Itgb4), partial

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Integrin beta-4 (Itgb4), partial

Recombinant Rat Integrin beta-4 (Itgb4), partial, is a purified recombinant protein derived from the rat species. It is a partial form of the integrin beta-4 subunit, which plays a crucial role in forming the integrin alpha-6/beta-4 complex. This complex is essential for cell adhesion to laminins and is a key component of hemidesmosomes in epithelial cells .

Structure and Function

Integrin beta-4 is a transmembrane protein that, when paired with integrin alpha-6, forms a receptor for laminins. This receptor complex is vital for maintaining the structural integrity of hemidesmosomes, which anchor epithelial cells to the basement membrane . The beta-4 subunit contains a large cytoplasmic domain with multiple phosphorylation sites, which are crucial for signaling functions .

Key Features:

  • Species: Rat (Rattus norvegicus)

  • Purity: Greater than 85% as determined by SDS-PAGE

  • Expression System: In vitro E. coli expression system

  • Tag: N-terminal 6xHis-tagged

  • Theoretical Molecular Weight: Approximately 80.7 kDa

Biological Significance

The integrin alpha-6/beta-4 complex is not only involved in cell adhesion but also plays a role in signaling pathways. It binds to neuroregulin-1 (NRG1) and insulin-like growth factor 1 (IGF1), facilitating their respective signaling pathways . In cancer cells, integrin beta-4 can redistribute from hemidesmosomes to the cell edges, promoting cell migration and invasion .

Research Applications

Recombinant Rat Integrin beta-4 (Itgb4), partial, is used in various research applications, including studies on cell adhesion, signaling pathways, and cancer biology. It can be utilized in biochemical assays to understand the interactions between integrin beta-4 and its ligands or in cell culture experiments to study the effects of altered integrin expression on cell behavior.

Applications:

  • Cell Adhesion Studies: To investigate the role of integrin beta-4 in cell adhesion to laminins.

  • Signaling Pathway Analysis: To examine the involvement of integrin beta-4 in NRG1 and IGF1 signaling.

  • Cancer Research: To study the redistribution of integrin beta-4 in cancer cells and its impact on cell migration and invasion.

Handling Precautions:

  • Store at recommended temperatures to maintain stability.

  • Avoid repeated freeze-thaw cycles.

Table 2: Applications of Recombinant Rat Integrin beta-4 (Itgb4), partial

ApplicationDescription
Cell Adhesion StudiesInvestigate integrin beta-4 role in adhesion to laminins
Signaling Pathway AnalysisExamine involvement in NRG1 and IGF1 signaling
Cancer ResearchStudy redistribution in cancer cells and impact on migration

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol.
Please note that if you have a specific requirement for the glycerol content, kindly indicate it in your order remarks.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based solution containing 6% Trehalose.

Form
The delivery form is available as either Liquid or Lyophilized powder.
We prioritize shipping the format currently in stock. However, if you have a specific requirement for the format, please indicate it in your order remarks, and we will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
Itgb4; Integrin beta-4; GP150; CD antigen CD104
Datasheet & Coa
Please contact us to get it.
Expression Region
28-713aa
Mol. Weight
92.2 kDa
Protein Length
Extracellular Domain
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Source
in vitro E.coli expression system
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
SLTENVEEFWDKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLEEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDGTHVCQLAKEDQRGNIHLKPSFSDGLRMDASVICDMCACELQKEVQSARCHYRGDFMCGHCVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECGRCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCLPAPS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Integrin alpha-6/beta-4 functions as a receptor for laminin, playing a crucial structural role within the hemidesmosome of epithelial cells. It is essential for regulating keratinocyte polarity and motility. The interaction between ITGA6:ITGB4 and NRG1 (via its EGF domain) is critical for NRG1-ERBB signaling. Similarly, ITGA6:ITGB4 binds to IGF1 and IGF2, facilitating their respective signaling pathways.
Gene References Into Functions
  1. This study suggests that downregulation of integrin beta4 is crucial for the development of ozone stress-induced airway hyperresponsiveness, likely due to increased oxidative damage and epithelial apoptosis. PMID: 20510671
  2. Changes in transcription factors, c-Jun and krox-20, and integrin beta4 expression are temporally correlated with the process of demyelination, suggesting their roles in regulating the myelin response to CNC injury. PMID: 19765400
  3. The SDL segment of the beta4 integrin subunit is required for ligand binding and plays a role in outside-in signaling. PMID: 12867433
  4. During the early stages of myelination, PMP22 and beta4 integrin are coexpressed at the DRG cell surface and can be coimmunoprecipitated together with laminin and alpha6 integrin. PMID: 16436605
Database Links
Protein Families
Integrin beta chain family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell membrane; Lipid-anchor. Cell junction, hemidesmosome.

Q&A

Basic Research Questions

  • What is Integrin beta-4 (Itgb4) and what are its primary functions in cellular biology?

Integrin beta-4 (Itgb4) is a transmembrane receptor subunit that primarily associates with integrin alpha-6 to form the alpha 6 beta 4 integrin complex. This complex functions as a receptor for several laminin isoforms, including laminin 1, 2, 4, and 5, playing a critical role in cell-matrix adhesion. The alpha 6 beta 4 integrin complex is essential for the formation and maintenance of hemidesmosomes in epithelial cells, which anchor cells to the basement membrane. Additionally, it is required for the regulation of keratinocyte polarity and motility . In molecular signaling pathways, ITGA6:ITGB4 binds to proteins such as NRG1 (via EGF domain), IGF1, and IGF2, mediating their downstream signaling cascades . Research has demonstrated that the cytoplasmic domain of beta 4 is critical for hemidesmosome assembly, as demonstrated by studies using tail-less beta 4 mutants .

  • What structural domains characterize the Recombinant Rat Integrin beta-4 protein?

The Recombinant Rat Integrin beta-4 (partial) typically refers to the extracellular domain, spanning amino acids 28-713, with an N-terminal 6xHis-tag and a molecular weight of approximately 80.2 kDa . The full-length Integrin beta-4 has a calculated molecular weight of 195 kDa based on its 1752 amino acid sequence, though it often appears as 200-240 kDa in experimental observations due to post-translational modifications . The protein contains two principal functional domains: the extracellular (or "head") domain responsible for laminin binding, and the cytoplasmic (or "tail") domain that mediates interactions with intracellular components and signaling molecules. Experimental studies have utilized domain-specific mutants (tail-less or head-less variants) to investigate the distinct functions of these domains, revealing that the cytoplasmic domain is essential for hemidesmosome assembly while not directly affecting laminin binding capability .

  • What experimental approaches are most effective for studying Itgb4-mediated cellular adhesion?

The study of Itgb4-mediated cellular adhesion requires complementary experimental approaches. Cell adhesion assays using purified laminin isoforms (1, 2, 4, and 5) provide direct measurement of Itgb4's adhesive properties. To isolate Itgb4-dependent adhesion from other integrin-mediated adhesion, researchers should incorporate blocking anti-beta 1 antibodies in their experimental design . Radioligand-binding assays offer quantitative assessment of the interaction between alpha 6 beta 4 integrin and various laminin isoforms . For visualizing adhesive structures, immunofluorescence microscopy targeting hemidesmosomal components provides spatial information about Itgb4 localization, while electron microscopy offers ultrastructural details of hemidesmosomes . Functional studies often employ dominant-negative approaches with mutant Itgb4 constructs (such as tail-less or head-less variants) to selectively disrupt specific aspects of Itgb4 function . Cell lines commonly used for these studies include bladder epithelial 804G cells, A431, A549, HT-29, HeLa, and MCF-7 cells, which naturally express Itgb4 .

Advanced Research Questions

  • How can dominant negative approaches be optimized to study distinct functions of Itgb4 in experimental settings?

Dominant negative approaches offer powerful tools for dissecting specific functions of Itgb4 in experimental settings. Based on published research, the optimization of these approaches requires careful consideration of several factors. First, construct design is critical—studies have demonstrated that tail-less beta 4 mutants (lacking the cytoplasmic domain) specifically disrupt hemidesmosome assembly without affecting laminin adhesion, while head-less mutants (lacking the extracellular domain) do not significantly alter either function . This differential effect allows researchers to selectively target hemidesmosome assembly while preserving adhesive properties. Second, expression levels must be carefully controlled, as adequate overexpression of the mutant protein relative to endogenous Itgb4 is essential for observing dominant negative effects . Third, appropriate cellular models such as 804G bladder epithelial cells, which naturally form hemidesmosomes, provide optimal systems for these studies . Fourth, comprehensive functional assessment should include multiple endpoints: immunofluorescence to visualize hemidesmosomal components, electron microscopy to confirm ultrastructural changes, and adhesion assays to verify preserved adhesive functions . This optimization strategy enables researchers to selectively interfere with specific Itgb4 functions while maintaining others, allowing precise delineation of its diverse biological roles.

  • What is the relationship between Itgb4 expression and cancer prognosis across different tumor types?

  • How do the mechanisms of Itgb4-mediated hemidesmosome assembly differ from its adhesion functions?

Research has revealed fundamental differences between Itgb4-mediated hemidesmosome assembly and its adhesion functions. Experimental evidence using domain-specific mutants demonstrates that these processes have distinct molecular requirements. The cytoplasmic domain of Itgb4 is essential for hemidesmosome assembly but dispensable for initial laminin adhesion—overexpression of tail-less beta 4 mutants dramatically reduces hemidesmosome formation without affecting adhesion to laminin substrates . Conversely, the extracellular domain is critical for laminin binding, but head-less beta 4 mutants do not disrupt existing hemidesmosomes . This functional separation indicates that adhesion to laminin occurs through the extracellular domain of the alpha 6 beta 4 complex, while hemidesmosome assembly requires the cytoplasmic domain to recruit and organize additional components such as plectin, BP180, and BP230 . The process of adhesion represents the initial interaction with extracellular matrix components, while hemidesmosome assembly involves complex intracellular scaffolding and cytoskeletal reorganization events downstream of this initial adhesion . These distinct molecular requirements highlight the multifunctional nature of Itgb4, enabling it to participate in both immediate adhesion responses and the establishment of stable epithelial attachment structures.

  • What considerations are important when developing phospho-specific antibodies against Itgb4 for signaling studies?

Developing phospho-specific antibodies against Itgb4 requires careful consideration of several factors to ensure specificity and utility in signaling studies. First, target site selection is critical—researchers should identify physiologically relevant phosphorylation sites that change in response to stimuli or during biological processes of interest. Second, immunogen design must include the exact phosphorylated amino acid sequence with sufficient flanking residues (typically 10-15 amino acids) to ensure specificity, while confirming the sequence is unique to Itgb4 to prevent cross-reactivity with other integrins or phosphoproteins. Third, comprehensive validation protocols are essential, including Western blotting with phosphorylated versus dephosphorylated controls, immunoprecipitation to verify target specificity, and immunofluorescence to confirm expected localization patterns . Antibody performance should be tested across multiple applications (WB, IP, IHC, IF) as phospho-epitopes may be differentially accessible in various techniques . Fourth, appropriate experimental controls must accompany all phospho-antibody studies, including phosphatase-treated samples and stimulation with factors known to induce Itgb4 phosphorylation. Fifth, fixation methods for immunohistochemistry require optimization, with Tris-EDTA buffer (pH 9.0) showing good results for Itgb4 detection . These methodological considerations ensure that phospho-specific antibodies provide reliable insights into Itgb4 signaling dynamics across experimental systems.

Experimental Design and Methodology

  • What are the optimal approaches for isolating functional Itgb4 complexes from rat tissues?

Isolating functional Itgb4 complexes from rat tissues requires a carefully optimized protocol to maintain native interactions while achieving sufficient purity. Based on current methodologies, the following approach is recommended: First, select appropriate tissues—epithelial-rich tissues like skin, bladder, or intestinal epithelium contain abundant Itgb4 complexes . Second, implement gentle homogenization conditions using buffers containing 0.5-1% non-ionic detergents (Triton X-100 or NP-40), protease and phosphatase inhibitors, 1-2 mM divalent cations (Ca²⁺/Mg²⁺) to maintain integrin conformation, and 10-20% glycerol for stability . Third, employ a multi-step purification strategy beginning with differential centrifugation to isolate membrane fractions, followed by immunoaffinity purification using specific anti-Itgb4 antibodies (such as 21738-1-AP) . Fourth, verify complex integrity through Western blotting for both Itgb4 (typically appearing at 200-240 kDa) and expected partners like alpha-6 integrin . Fifth, for functional studies, confirm that isolated complexes retain laminin-binding capacity through solid-phase binding assays with purified laminin isoforms (1, 2, 4, or 5) . This systematic approach maximizes the yield of functionally intact Itgb4 complexes suitable for downstream biochemical and proteomic analyses.

  • What are the recommended procedures for optimizing immunohistochemical detection of Itgb4 in rat tissue samples?

Optimizing immunohistochemical detection of Itgb4 in rat tissue samples requires attention to several critical parameters. Based on published methodologies, the following protocol is recommended: First, tissue fixation should use 10% neutral buffered formalin for 24-48 hours followed by paraffin embedding, with sections cut at 4-5 μm thickness . Second, antigen retrieval is crucial—use Tris-EDTA buffer (pH 9.0) as the primary method, with citrate buffer (pH 6.0) as an alternative if needed . Heat-induced epitope retrieval should be performed at 95-98°C for 15-20 minutes. Third, for primary antibody incubation, use anti-Itgb4 antibody (such as 21738-1-AP) at a dilution of 1:300-1:1200, with optimization for each specific tissue type . Fourth, detection systems should employ polymer-based methods rather than avidin-biotin systems to reduce background. Fifth, include appropriate controls: positive controls (rat colon tissue), negative controls (primary antibody omission), and competing peptide controls . The optimized staining protocol typically reveals Itgb4 localization at the basal aspect of epithelial cells where hemidesmosomes form. Evaluation should focus on staining intensity, pattern (membranous versus cytoplasmic), and distribution within the tissue. This comprehensive approach enables reliable immunohistochemical detection of Itgb4 in rat tissue samples.

  • How can researchers effectively measure Itgb4-laminin binding kinetics and affinity?

Measuring Itgb4-laminin binding kinetics and affinity requires specialized methodologies that capture the complexity of these molecular interactions. The optimal experimental design incorporates multiple complementary approaches: First, solid-phase binding assays using purified recombinant Itgb4 (typically the extracellular domain, amino acids 28-713) immobilized on microplates, with increasing concentrations of labeled laminin isoforms (1, 2, 4, or 5) . This approach yields binding curves from which apparent dissociation constants (Kd) can be calculated. Second, surface plasmon resonance (SPR) provides real-time, label-free measurement of association and dissociation rates (kon and koff) between immobilized Itgb4 and flowing laminin solutions. Third, cellular binding assays using cells expressing either wild-type or mutant Itgb4, with radioligand-binding approaches providing quantitative assessment of laminin binding to intact cells . Fourth, competitive binding assays with various laminin isoforms help determine relative binding preferences. Fifth, the influence of divalent cations (Ca²⁺, Mg²⁺, Mn²⁺) on binding should be assessed, as these ions often modulate integrin-ligand interactions. For all approaches, proper controls are essential, including blocking experiments with function-blocking antibodies against Itgb4 or beta 1 integrins to distinguish Itgb4-specific binding . This comprehensive methodology provides detailed characterization of the binding parameters governing Itgb4-laminin interactions.

  • What cell-based assays most effectively demonstrate the functional consequences of Itgb4 mutations?

Assessing the functional consequences of Itgb4 mutations requires a battery of cell-based assays that target different aspects of Itgb4 biology. The most effective experimental design includes: First, hemidesmosome assembly assays—transfect cells (preferably 804G or other hemidesmosome-forming lines) with wild-type or mutant Itgb4 constructs and quantify hemidesmosome formation using immunofluorescence for key components (Itgb4, plectin, BP180, BP230) and electron microscopy for ultrastructural confirmation . Second, adhesion assays—measure cell attachment to various laminin isoforms (1, 2, 4, 5) in the presence of beta 1 integrin-blocking antibodies to isolate Itgb4-dependent adhesion . Third, migration assays (wound healing, transwell) to assess how mutations affect cell motility, as Itgb4 regulates keratinocyte migration . Fourth, signaling assays measuring phosphorylation of downstream targets after stimulation with growth factors that utilize Itgb4 as a signaling partner (NRG1, IGF1, IGF2) . Fifth, protein-protein interaction assays (co-immunoprecipitation, proximity ligation) to determine how mutations affect interactions with key binding partners . Sixth, cellular localization studies using confocal microscopy to track the distribution of mutant proteins. This comprehensive suite of assays enables researchers to characterize how specific mutations affect the diverse functions of Itgb4, from structural roles in hemidesmosomes to participation in signaling pathways.

Data Analysis and Interpretation

  • How should researchers interpret changes in Itgb4 expression patterns across different cancer stages?

Interpreting changes in Itgb4 expression patterns across cancer stages requires a multifaceted analytical approach that accounts for the context-dependent nature of Itgb4 functions. Analysis of TCGA data reveals that Itgb4 expression correlates with prognosis differently across cancer types, suggesting stage-specific roles . When analyzing expression changes, researchers should first establish cancer type-specific baseline expression in normal tissues corresponding to the cancer of interest. Second, implement quantitative comparisons across stages using standardized expression metrics (such as log2 TPM) while controlling for potential confounding factors including tumor purity and patient demographics . Third, correlate expression changes with histopathological features, particularly focusing on epithelial-mesenchymal transition markers, as Itgb4's role may shift during this process. Fourth, integrate expression data with mutation and copy number analysis to identify potential mechanisms driving expression changes. Fifth, perform survival analyses using Kaplan-Meier methods and Cox proportional hazards models, stratified by stage, to determine if Itgb4's prognostic significance varies with disease progression . The following table summarizes the stage-dependent prognostic significance of Itgb4 across selected cancer types:

Cancer TypeEarly Stage PrognosisAdvanced Stage PrognosisStatistical Significance
KIRCPoor OS and DFSPoor OS and DFSP = 0.041 (OS), P = 0.039 (DFS)
LGGPoor OS and DFSPoor OS and DFSP < 0.001 (OS and DFS)
LUADPoor OS and DFSPoor OS and DFSP = 0.00073 (OS), P = 0.0017 (DFS)
GastricPoor OS, PPS, FSPoor OS, PPS, FSP < 0.001 (all metrics)
OvarianBetter OS, Poor PFSVariableP = 0.0017 (OS), P = 0.013 (PFS)
LiverBetter OS and DSSVariableP = 0.0091 (OS), P = 0.017 (DSS)

This stage-specific analytical framework enables researchers to develop nuanced interpretations of how Itgb4 expression changes contribute to cancer progression.

  • What bioinformatic approaches are most valuable for predicting functional consequences of Itgb4 mutations?

Predicting the functional consequences of Itgb4 mutations requires specialized bioinformatic approaches that address the protein's structural and functional complexity. The most valuable computational strategy involves: First, sequence conservation analysis across species, focusing particularly on rat (UniProt ID: Q64632) and human (UniProt ID: P16144) orthologs to identify evolutionarily constrained regions likely critical for function . Second, domain-specific impact prediction—mutations in the extracellular domain (amino acids 28-713) may affect laminin binding, while alterations in the cytoplasmic domain more likely disrupt hemidesmosome assembly or signaling functions . Third, structural modeling using tools like AlphaFold to predict how mutations might alter protein folding, stability, or interaction interfaces. Fourth, functional site prediction focusing on key regions known to mediate specific functions—laminin binding sites in the extracellular domain or phosphorylation sites and protein interaction motifs in the cytoplasmic domain . Fifth, signaling impact prediction for mutations near sites that interact with signaling partners (NRG1, IGF1, IGF2) . Sixth, integration with clinical databases such as TCGA to correlate predicted functional impacts with observed phenotypes in patients . This comprehensive bioinformatic approach enables researchers to prioritize mutations for experimental validation and develop testable hypotheses about their mechanistic consequences, facilitating the translation of genetic findings into functional understanding of Itgb4 biology.

  • How can researchers distinguish between direct and indirect effects when studying Itgb4 signaling pathways?

Distinguishing between direct and indirect effects in Itgb4 signaling pathways requires rigorous experimental designs that isolate specific molecular interactions. The most effective approach combines multiple complementary strategies: First, implement temporal analysis—direct effects typically occur rapidly (seconds to minutes) after stimulation, while indirect effects emerge later (minutes to hours). Second, employ domain-specific mutants, particularly those lacking the cytoplasmic (tail-less) or extracellular (head-less) domains, to determine which regions are required for specific signaling events . Third, utilize phosphorylation-deficient mutants by substituting key phosphorylatable residues (serine, threonine, tyrosine) with non-phosphorylatable amino acids to identify essential phosphorylation events. Fourth, perform protein-protein interaction studies using co-immunoprecipitation or proximity ligation assays to verify direct physical interactions between Itgb4 and putative binding partners . Fifth, implement in vitro reconstitution assays with purified recombinant proteins to determine if interactions can occur in the absence of other cellular components . Sixth, apply pharmacological approaches using specific kinase inhibitors or activators to determine the requirement for particular signaling molecules. Finally, combine these approaches with mathematical modeling of signaling networks to predict and test the consequences of perturbations at different points in the pathway. This systematic approach enables researchers to establish causal relationships within Itgb4 signaling networks and distinguish primary molecular events from downstream consequences.

  • What quality control parameters are essential when working with recombinant Itgb4 proteins?

Working with recombinant Itgb4 proteins requires rigorous quality control to ensure experimental reliability. Based on established protocols, the following parameters are essential: First, purity assessment—greater than 85% purity should be confirmed via SDS-PAGE, with possible contaminants identified through mass spectrometry . Second, identity verification through Western blotting with specific antibodies and peptide mass fingerprinting to confirm the correct sequence. Third, integrity analysis—recombinant Itgb4 partial protein (typically containing amino acids 28-713) should appear at the expected molecular weight (approximately 80.2 kDa for the extracellular domain) . Fourth, structural integrity assessment via circular dichroism spectroscopy to verify proper folding. Fifth, functional validation through laminin binding assays, as alpha 6 beta 4 integrin is known to bind laminin isoforms 1, 2, 4, and 5 . Sixth, stability monitoring during storage—recommended conditions include 50% glycerol buffer at -20°C/-80°C, with shelf life typically 6 months for liquid form and 12 months for lyophilized preparations . Seventh, freeze-thaw sensitivity testing, as repeated freezing and thawing is not recommended; working aliquots should be stored at 4°C for up to one week . Eighth, endotoxin testing for proteins intended for cell-based assays, with levels below 1 EU/mg protein. Proper documentation of these parameters ensures that experimental results with recombinant Itgb4 proteins are reproducible and biologically relevant.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.