Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Signaling

Il2rb forms part of the IL-2 and IL-15 receptor complexes, enabling both cytokine binding and signal transduction:

  • IL-2 Receptor Assembly:

    • High-affinity receptor: Requires α (CD25), β (Il2rb), and γc (CD132) subunits .

    • Intermediate-affinity receptor: Composed of β and γc subunits .

  • IL-15 Receptor: Shares Il2rb with the γc subunit for signaling .

  • Key Functions:

    • Promotes CD8+ T cell proliferation and survival .

    • Critical for regulatory T (Treg) cell function via STAT5 activation .

    • Facilitates IL-15-mediated neutrophil phagocytosis .

Role in Treg Cell Function

  • Genetic Knockout Studies:

    • Conditional deletion of Il2rb in Treg cells led to fatal autoimmune inflammation due to uncontrolled CD8+ T cell activation .

    • Rescue experiments showed that STAT5b-CA (constitutively active STAT5) restored Treg cell numbers but not IL-2 consumption capacity, highlighting STAT5's role in Treg survival .

  • IL-2 Depletion: Neutralizing IL-2 in Il2rb-deficient mice reduced CD8+ T cell activation, suggesting IL-2 sequestration by Treg cells is critical for immune regulation .

Table 2: Phenotypic Outcomes of Il2rb Deficiency in Mice

ParameterObservation
Treg Cell FrequencyReduced in Il2rb⁻/⁻ mice
CD8+ T Cell ActivationMarkedly increased, leading to lymphoproliferation
STAT5 SignalingEssential for Treg suppressor function; rescued via STAT5b-CA expression

Applications in Receptor-Ligand Interaction Studies

  • Binding Affinity: Recombinant Il2rb binds IL-2 with low affinity (Kd ~10⁻⁸ M) and IL-15 with higher affinity, making it useful for studying IL-15 neutralization .

  • Signaling Assays: Used to dissect JAK-STAT pathway activation in T cells and NK cells .

Challenges and Future Directions

  • Functional Redundancy: IL-15 partially compensates for IL-2 signaling in thymic Treg development but not in peripheral cells .

  • Therapeutic Potential: Targeting Il2rb could modulate autoimmune diseases or enhance antitumor immunity, though off-target effects on IL-15 signaling remain a concern .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Il2rb; Interleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; p70-75; CD antigen CD122
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-537
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKEIFPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGGDLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASCFTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDYCAFPPRDDLLLFSPSMSTPNTAYGNSITPEERPPLSLQEGLPSLASPDLMGLQHPLELELGDDGEGMSTNSSGQQASVPEAALMGTTKTEARPVLTLNTDAYLSLQELQAQDSAHLI
Uniprot No.

Target Background

Function
This beta subunit is the receptor for interleukin-2. It plays a role in receptor-mediated endocytosis and transduces the mitogenic signals of IL2. In association with IL15RA, it is likely involved in the stimulation of neutrophil phagocytosis by IL15.
Database Links

KEGG: rno:25746

STRING: 10116.ENSRNOP00000064699

UniGene: Rn.5832

Protein Families
Type I cytokine receptor family, Type 4 subfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface.

Q&A

What is the molecular structure of rat IL-2 receptor subunit beta (IL2rb) and how does it differ from other IL-2 receptor components?

Rat IL-2 receptor beta (IL2rb), also known as CD122, is a 75 kDa type I membrane glycoprotein that serves as a critical component of both IL-2 and IL-15 receptor complexes . Unlike the IL-2 receptor alpha subunit (CD25) which has a molecular weight of approximately 55 kDa, IL2rb has a more substantial extracellular domain that contributes to cytokine binding . The structural difference is significant because IL2rb participates directly in signal transduction alongside the common gamma chain (γc/CD132), whereas IL-2Rα primarily functions to increase binding affinity without direct signaling capacity . IL2rb contains specific domains in its cytoplasmic region that recruit and activate JAK/STAT signaling molecules upon cytokine binding, enabling downstream signal transduction essential for immune cell responses.

How do the different IL-2 receptor subunits contribute to receptor affinity and specificity?

The IL-2 receptor system demonstrates a hierarchical organization of binding affinity based on subunit composition:

Receptor ComplexComponentsBinding AffinityExpression Pattern
Low affinityIL-2Rα (CD25) aloneLowActivated T cells, Tregs
Intermediate affinityIL-2Rβ (CD122) + γc (CD132)IntermediateNK cells, memory T cells
High affinityIL-2Rα + IL-2Rβ + γcHighActivated T cells, Tregs

IL-2Rβ and γc dimerization forms the constitutively expressed intermediate affinity IL-2 receptor . This dimer is capable of responding to higher concentrations of IL-2. When all three subunits (IL-2Rα, IL-2Rβ, and γc) associate, they generate a ternary high-affinity IL-2 receptor complex that can respond to significantly lower concentrations of IL-2 . The differential expression of these receptor components across immune cell populations enables selective responsiveness to IL-2, with important implications for immune cell homeostasis and activation dynamics.

What are the recommended protocols for working with recombinant rat IL2rb in experimental settings?

When working with recombinant rat IL2rb in experimental settings, researchers should consider the following methodological approaches:

Protein Reconstitution and Storage:

  • For carrier-free recombinant proteins (CF format), reconstitute lyophilized protein at 500 μg/mL in sterile PBS

  • Use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity

  • For short-term storage (≤1 month), store at 2-8°C in working aliquots

  • For long-term storage, prepare aliquots and store at -20°C to -80°C

Functional Validation:

  • Confirm binding specificity using competitive binding assays with labeled IL-2

  • Verify signal transduction capacity through phosphorylation assays measuring JAK/STAT activation

  • Assess functional activity through proliferation assays with IL-2 responsive cell lines

When designing experiments, it's critical to distinguish between receptor-mediated effects and potential artifacts due to improper protein handling or formulation issues.

How can researchers effectively measure IL2rb-mediated signaling in rat immune cells?

Researchers can employ several complementary techniques to measure IL2rb-mediated signaling:

  • Phospho-flow cytometry: Enables detection of phosphorylated signaling molecules (STAT5, AKT, ERK) at the single-cell level with lineage marker correlation

  • Western blotting: Provides quantitative assessment of phosphorylated signaling proteins downstream of IL2rb

  • Reporter cell assays: Engineered cells expressing rat IL2rb and STAT5-responsive reporters allow functional assessment of receptor activity

  • RNA-seq analysis: Identifies transcriptional changes associated with IL2rb activation

  • Bioassay systems: Measures functional responses in IL-2-dependent cell lines expressing rat IL2rb

In bioassay applications, the effective dose (ED50) for IL-2-mediated proliferation typically ranges between 0.04-0.2 ng/mL in appropriate responsive lines . When designing these assays, careful titration of recombinant IL-2 concentrations is essential to differentiate between high-affinity and intermediate-affinity receptor-mediated responses.

How does IL2rb contribute to differential signaling outcomes in distinct immune cell populations?

IL2rb participates in differential signaling outcomes across immune cell populations through several mechanisms:

  • Expression level variation: The density of IL2rb expression varies across NK cells, CD8+ T cells, and memory CD4+ T cells, influencing sensitivity to IL-2

  • Co-receptor association: IL2rb interacts with different co-receptors and signaling molecules depending on cell type and activation state

  • Signaling pathway balance: The relative activation of JAK/STAT, PI3K/AKT, and MAPK pathways downstream of IL2rb differs across cell types

Research has demonstrated that IL-2 signaling through IL2rb/γc (without IL-2Rα) preferentially promotes the expansion of NK cells, CD8+ T cells, and γδ T cells relative to CD4+ T cells and regulatory T cells (Tregs) . This differential response forms the basis for developing IL-2 variants with selective receptor binding properties to enhance anti-tumor immune responses while minimizing Treg expansion that might suppress effective immunity .

What approaches can be used to selectively target IL2rb-expressing cells without activating IL-2Rα-expressing populations?

Selective targeting of IL2rb-expressing cells has emerged as a significant research direction with therapeutic implications. Several approaches include:

  • Engineered IL-2 variants: Creating modified IL-2 molecules that retain IL2rb/γc binding but have reduced or eliminated IL-2Rα binding capacity

  • Polymer conjugation strategies: Attaching polymers to block the IL-2Rα binding interface while preserving IL2rb interaction sites

  • Prodrug approaches: Developing prodrugs like TransCon IL-2 β/γ that provide sustained release of IL2rb-selective IL-2 variants

  • Antibody-cytokine fusions: Creating fusion proteins that target IL-2 activity to specific anatomical locations or cell populations

The TransCon IL-2 β/γ approach demonstrates how these principles can be implemented effectively. By permanently attaching a small methoxy polyethylene glycol (mPEG) moiety to the IL-2Rα binding site, researchers created an IL-2 variant (IL-2 β/γ) that selectively activates IL2rb/γc without IL-2Rα interactions . This modification, combined with a transient conjugation to a larger mPEG carrier, creates sustained release kinetics with reduced peak concentrations (low Cmax) and an extended half-life (>30 hours) .

How does the signaling capacity of IL2rb differ when engaged by IL-2 versus IL-15?

Both IL-2 and IL-15 utilize IL2rb in their receptor complexes, but with important functional differences:

FeatureIL-2 SignalingIL-15 Signaling
Receptor compositionIL-2Rα (CD25), IL2rb (CD122), γc (CD132)IL-15Rα, IL2rb (CD122), γc (CD132)
Primary responsive cellsActivated T cells, Tregs, NK cellsNK cells, memory CD8+ T cells, IELs
Trans-presentationMinimalSignificant via IL-15Rα
Physiological roleT cell proliferation, AICD, Treg maintenanceNK cell development, memory CD8+ T cell survival

While both cytokines activate similar downstream signaling cascades through IL2rb/γc, their distinct biological outcomes result from differences in receptor complex assembly, presentation mode, and the cellular contexts in which they operate . Understanding these distinctions is crucial for experimental design involving either cytokine and for interpreting observed biological effects.

What methodologies can distinguish IL2rb-specific effects from effects mediated by other receptor subunits?

To isolate IL2rb-specific effects, researchers can employ several complementary approaches:

  • Subunit-selective ligands: Use engineered cytokines like IL-2 β/γ that selectively engage IL2rb/γc without IL-2Rα involvement

  • Blocking antibodies: Apply antibodies that specifically block either IL2rb or other receptor subunits

  • Genetic approaches: Utilize CRISPR/Cas9 or siRNA to selectively knock out or knock down IL2rb while leaving other subunits intact

  • Chimeric receptors: Create receptor constructs where the extracellular domain of IL2rb is fused to alternative signaling domains

In functional studies, researchers have demonstrated that IL-2 β/γ variants enhance proliferation and cytotoxicity of primary human CD8+ T cells, NK cells, and γδ T cells . The differential expansion of these cell populations compared to CD4+ T cells, Tregs, and eosinophils provides evidence that IL2rb/γc signaling, without IL-2Rα involvement, can drive distinct biological outcomes with potential therapeutic relevance .

What are common challenges when working with recombinant rat IL2rb and how can they be addressed?

Researchers often encounter several challenges when working with recombinant rat IL2rb:

  • Protein stability issues: The three-dimensional structure of IL2rb can be sensitive to storage and handling conditions. Maintain appropriate buffer conditions and avoid repeated freeze-thaw cycles .

  • Functional verification: Confirming that recombinant IL2rb retains native binding capacity and signaling functionality can be challenging. Implement multiple complementary functional assays to verify activity.

  • Species cross-reactivity: When using rat IL2rb in cross-species studies, carefully validate functional compatibility with human or mouse components, as receptor-ligand interactions may vary across species.

  • Carrier protein interference: For applications where the presence of carrier proteins might interfere, select carrier-free (CF) formulations rather than those containing bovine serum albumin (BSA) .

  • Concentration optimization: The optimal working concentration of IL2rb may vary across experimental systems. Perform careful titration experiments to determine appropriate concentrations for your specific application.

How can researchers optimize experimental designs to study IL2rb-mediated effects in complex immune responses?

To optimize experimental designs for studying IL2rb-mediated effects:

  • Include appropriate controls:

    • Isotype controls for antibodies

    • Receptor blocking experiments

    • Cytokine-deficient or receptor-deficient controls

  • Time-course analyses: IL-2 signaling effects can vary significantly with time. Design experiments with multiple time points to capture both immediate and delayed responses .

  • Multi-parameter readouts: Combine assessments of:

    • Receptor expression and phosphorylation (flow cytometry)

    • Functional outcomes (proliferation, cytotoxicity, cytokine production)

    • Transcriptional changes (RNA-seq, qPCR)

  • Physiologically relevant systems: Whenever possible, use primary cells rather than cell lines, and consider three-dimensional culture systems that better recapitulate tissue environments.

  • Careful cytokine dosing: IL-2 dose can dramatically affect which receptor complexes are engaged. Use dose ranges that selectively activate high-affinity (IL-2Rα/IL2rb/γc) versus intermediate-affinity (IL2rb/γc) receptors .

How might emerging technologies enhance our understanding of IL2rb biology and function?

Several emerging technologies offer promising approaches to advance our understanding of IL2rb:

  • Single-cell multi-omics: Integrated analysis of transcriptome, proteome, and phospho-proteome at single-cell resolution will reveal heterogeneity in IL2rb expression and signaling across immune cell populations.

  • Advanced protein engineering: Continued development of receptor-selective cytokines, including those with enhanced IL2rb specificity, will enable precise manipulation of specific signaling pathways .

  • Spatiotemporal imaging: Advanced microscopy techniques can visualize IL2rb clustering, trafficking, and signaling complex formation in living cells with unprecedented detail.

  • Computational modeling: Systems biology approaches can integrate multiple datasets to model how IL2rb contributes to complex immune cell decision-making processes.

  • Organoid and microphysiological systems: These technologies offer opportunities to study IL2rb function in more physiologically relevant contexts that better recapitulate tissue-specific immune environments.

What are the most significant unanswered questions regarding IL2rb in rat immune function?

Despite decades of research, several important questions about rat IL2rb remain to be fully addressed:

  • How does IL2rb expression and signaling in tissue-resident immune cells differ from circulating populations?

  • What are the epigenetic mechanisms controlling IL2rb expression during different stages of immune cell development and activation?

  • How do post-translational modifications of IL2rb regulate its signaling capacity and cellular localization?

  • What is the precise stoichiometry and structural organization of IL2rb-containing receptor complexes in different membrane microdomains?

  • How do metabolic states influence IL2rb expression and signaling capacity in different immune cell populations?

Addressing these questions will require integrative approaches combining advanced technologies with carefully designed experimental systems using recombinant rat IL2rb and related reagents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.