Recombinant Rat Inward rectifier potassium channel 13 (Kcnj13)

Shipped with Ice Packs
In Stock

Description

Introduction

The Inward Rectifier Potassium Channel 13 (Kcnj13), also known as Kir7.1, is a protein encoded by the KCNJ13 gene . Inward rectifier potassium channels, such as Kcnj13, facilitate potassium flow into the cell more readily than out of it . KCNJ13's function is essential for maintaining ion homeostasis in tracheal smooth muscle cells, which is required for actin polymerization . Mutations in KCNJ13 have been linked to snowflake vitreoretinal degeneration (SVD) and Leber congenital amaurosis (LCA) .

Gene Information

The KCNJ13 gene is associated with several key identifiers :

  • NCBI Gene ID: 3769

  • KEGG ID: rno:94341

  • STRING ID: 10116.ENSRNOP00000021507

  • UniGene ID: Rn.14516

The human ortholog of this gene is implicated in Leber congenital amaurosis 16 and snowflake vitreoretinal degeneration .

Protein Production and Characteristics

Recombinant Rat Inward rectifier potassium channel 13 (Kcnj13) is produced in vitro using an E. coli expression system .

Expression and Localization

Kcnj13 is predicted to be active in the plasma membrane . In mouse embryos, β-galactosidase staining reveals Kcnj13 expression in the eye lens, the choroidal plexus of the fourth and fifth ventricles of the brain, and the anterior retina at embryonic day E12.5 . By E15, expression increases in these areas and appears to a lesser extent in other parts of the embryo . In adult mice, strong β-galactosidase staining is observed in the retinal pigment epithelial cells (RPE) and the ciliary body, but not in the photoreceptor layers adjacent to the RPE .

Functional Studies in Knockout Mice

Kcnj13 knockout (KO) mice have been instrumental in studying the functional roles of this channel and its implications in retinal pathophysiology .

  • Early Lethality: Mice with a loss-of-function Kcnj13 mutation generated via N-ethyl-N-nitrosourea (ENU) mutagenesis exhibit neonatal lethal tracheal and smooth muscle defects . Similarly, mice with a deleted Kcnj13 gene locus die of respiratory and palatal deformities within the first day of life .

  • Retinal Degeneration: Studies using CRISPR-mediated genomic indels of Kcnj13 in mice have demonstrated that while RPE cells lacking Kir7.1 can survive, the underlying photoreceptors degenerate, a condition that can be rescued by nearby wild type or heterozygous RPE cells with an intact Kcnj13 gene .

  • Conditional Knockout Models: Conditional knockout models, such as the Best1-cre conditional knockout of Kcnj13 in the retina, result in thinning of the outer nuclear layer and reduced light responses in mice with a high percentage of cells lacking the Kcnj13 gene . The use of a TdTomato fluorescent indicator of Cre helps select mice with high levels of Cre expression, improving the consistency of retinal phenotypes .

  • Rescue Experiments: Replacement of Kcnj13 expression using recombinant Lentivirus can partially rescue potassium pump activity in the RPE, as evidenced by improvements in the ERG c-wave, but does not fully restore a- and b-wave amplitudes .

Table 1: Survival Rates of Kcnj13 Knockout Mice

GenotypeSurvival to Adulthood
Kcnj13 knockout first homozygous miceNot identified after E15.5
Conditional knockout homozygous miceSurvived to adulthood

Retinal Development and Pathophysiology

Research using conditional Kcnj13 knockout mice has confirmed and extended previous observations regarding the retinal pathophysiology associated with KCNJ13-based retinal degenerations . Early embryonic expression patterns of Kcnj13 align with the characteristics of SVD, LCA, and autosomal recessive retinitis pigmentosa (arRP) resulting from mutations in KCNJ13 . The ultimate pathology involves the death of retinal photoreceptors and subsequent degeneration of the outer retina, similar to other retinal degenerations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcnj13; Inward rectifier potassium channel 13; Inward rectifier K(+ channel Kir7.1; Potassium channel, inwardly rectifying subfamily J member 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnj13
Target Protein Sequence
MDSRNCKVNAPLLSQRYRRMVTKDGHSTLQMDGAQRGLVYLRDAWGILMDMRWRWMMLVF SASFVVHWLVFAVLWYAVAEMNGDLEIDHDVPPENHTICVKHITSFTAAFSFSLETQLTI GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH KDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGELYQTSVDFHLDGISSEECPFFIFP LTYYHTITPSSPLATLLQHETPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHRFA ALMTRGSKGEYQVKMENFDKTVPEHPTPVVSKSPHRTDLDIHINGQSIDNFQIAETGLTE
Uniprot No.

Target Background

Function

Inward rectifier potassium channels are characterized by a preferential influx of potassium ions. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel activation voltage range to more positive potentials. Inward rectification is primarily attributed to intracellular magnesium block. KCNJ13 exhibits low single-channel conductance, low sensitivity to barium and cesium block, and its inward rectification is independent of intracellular magnesium.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ13 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic function of Kcnj13?

Kcnj13 encodes the inwardly rectifying potassium channel Kir7.1, which belongs to the Kir superfamily. In rats, the Kcnj13 gene contains three exons that produce a dominant transcript of approximately 1.45 kb in the brain . The channel has unique pore properties compared to other Kir family members, influencing its specific physiological functions . Kir7.1 channels primarily regulate membrane potential and contribute to potassium homeostasis across various tissues. These channels demonstrate greater tendency to allow potassium ions to flow inward rather than outward, a property that distinguishes inwardly rectifying channels from other potassium channel types.

Where is Kcnj13/Kir7.1 primarily expressed in rodent tissues?

Kcnj13/Kir7.1 exhibits a distinct tissue-specific expression pattern across developmental stages and in adult tissues:

TissueDevelopmental StageExpression PatternDetection Method
BrainEmbryonic (E12.5-E13.5)Choroid plexus of lateral, third, and fourth ventriclesβ-galactosidase staining
BrainAdultPredominantly in choroid plexus and meningesReporter gene analysis
EyeEmbryonic (E12.5-E13.5)Anterior retina, lens primary nuclear fibersβ-galactosidase staining
EyeAdultRetinal pigment epithelium (RPE), ciliary bodyImmunofluorescence, β-galactosidase staining
TracheaDevelopingSmooth muscle cells (increasing with development)Immunofluorescence
EsophagusDevelopingSmooth muscle cells (increasing with development)Immunofluorescence

This expression pattern correlates with the tissues affected in both genetic models and human diseases linked to Kcnj13 mutations .

How is Kcnj13 gene expression regulated at the transcriptional level?

The transcriptional regulation of Kcnj13 has several distinctive features that differentiate it from other ion channel genes. Unlike many ion channels, the Kcnj13 promoter contains both TATA and CAAT boxes, which is uncommon for this gene family . The minimal promoter is controlled by AP-1 transcription factors and drives high gene expression levels .

Research using luciferase reporter gene assays has shown that the first 2.1 kb of the 5' flanking region produces similarly high expression levels in both epithelial FRTL-5 cells and neuronal N2A cells. This suggests that neuron-specific repressor elements are located remote from the minimal promoter, representing an interesting regulatory mechanism .

In developing tissues such as the trachea and esophagus, Kcnj13 expression increases as smooth muscle tissue matures, indicating developmental regulation of gene expression . Researchers investigating this phenomenon should consider temporal expression analysis when designing experiments targeting Kcnj13 function.

What animal models are available for studying Kcnj13 function?

Multiple mouse models have been developed to investigate Kcnj13 function, each with specific advantages for different research questions:

Model TypeGeneration MethodPhenotypeResearch Application
ENU-induced mutationN-ethyl-N-nitrosourea mutagenesis producing c.38T>C (p.Leu13Pro) mutationTracheal defects, neonatal lethalityStudying loss-of-function effects
Complete knockoutVelociGene deletion of Kcnj13 locusRespiratory and palatal deformities, early postnatal mortalityAnalyzing developmental requirements
"Knockout first"Gene trap cassette with β-galactosidase in intron 1Similar to complete knockout, allows visualization of expressionExpression pattern analysis
Conditional knockoutFloxed Kcnj13 with tissue-specific Cre (e.g., VMD2-Cre for RPE)Tissue-specific phenotypes (e.g., retinal degeneration with RPE-Cre)Tissue-specific function analysis
CRISPR mosaicCRISPR-mediated genomic indelsMosaic expression patterns allowing comparison of WT and mutant cells in same tissueCell-autonomous function analysis

When designing experiments, researchers should select the appropriate model based on their specific research questions. For developmental studies, the "knockout first" allele with β-galactosidase reporter is valuable for expression analysis, while conditional knockouts are essential for investigating tissue-specific functions past embryonic stages without the complication of early lethality .

How can Kcnj13 channel activity be effectively measured in experimental settings?

Researchers employ several complementary techniques to assess Kcnj13/Kir7.1 channel activity:

Membrane Potential Assays

Voltage-sensitive fluorescent dyes such as DiBAC₄(3) can detect membrane potential changes resulting from Kcnj13 activity. Increased fluorescence intensity indicates membrane depolarization, as observed in Kcnj13 mutant smooth muscle cells . This method allows for real-time monitoring of channel function in intact cells.

Pharmacological Manipulation

Specific inhibitors such as VU590 (50 μM) can block KCNJ13 function, mimicking loss-of-function mutations . Treating wild-type tissues with these inhibitors provides a useful approach to validate phenotypes observed in genetic models and assess acute versus chronic effects of channel dysfunction.

Electrophysiological Assessment

For retinal studies, electroretinography (ERG) provides a physiologically relevant assessment of channel function in vivo. Particularly informative is the c-wave, which specifically reflects RPE activity and is directly influenced by Kcnj13 function . Conditional knockout mice with RPE-specific deletion of Kcnj13 show characteristic changes in ERG parameters that can be partially rescued by gene therapy approaches .

When designing experiments to measure Kcnj13 function, researchers should consider combining multiple approaches to obtain comprehensive data on channel activity, from molecular-level electrophysiology to tissue-level functional outcomes.

What strategies are most effective for generating conditional knockout models of Kcnj13?

Generation of conditional knockout models for studying tissue-specific functions of Kcnj13 involves several strategic steps:

  • Design of the targeting construct:

    • Insert an intron trap cassette with a splice acceptor site (e.g., En2) in intron 1

    • Include FRT sites flanking the cassette for later removal by FLP recombinase

    • Flank exon 2 with LoxP sites for Cre-mediated excision

  • Embryonic stem cell targeting:

    • Introduce the construct into mouse embryonic stem cells (e.g., R1 SV129) via homologous recombination

    • Select positive clones and verify correct integration through appropriate screening methods

  • Generation of the "knockout first" allele:

    • Create chimeric mice and breed to establish germline transmission

    • The initial allele functions as a knockout and expresses β-galactosidase, enabling expression pattern analysis

  • Conversion to conditional allele:

    • Cross with mice expressing FLP recombinase to remove the gene trap cassette

    • This generates a functional but floxed Kcnj13 allele (conditional ready)

  • Tissue-specific knockout:

    • Cross floxed Kcnj13 mice with appropriate Cre-expressing lines

    • For retinal studies, VMD2-Cre mice provide RPE-specific deletion

    • Verify tissue-specific deletion using immunofluorescence or other detection methods

A critical consideration when using the VMD2-Cre line is the variability in Cre expression levels between individual mice, resulting in mosaic deletion patterns. Researchers should implement appropriate screening methods, such as using TdTomato fluorescent indicators of Cre activity, to select mice with high levels of Cre expression for consistent experimental outcomes .

How can Kcnj13 expression be effectively visualized in tissue samples?

Multiple approaches can be implemented for visualizing Kcnj13 expression in experimental settings:

Reporter Gene Systems

The "knockout first" allele with β-galactosidase expression from a gene trap cassette provides an excellent tool for expression analysis . This approach enables whole-mount staining of tissues and detection in tissue sections, with staining intensity correlating with endogenous gene expression levels. This method has proven particularly valuable for tracing Kcnj13 expression during embryonic development in structures like the ventricular system and developing eye .

Immunofluorescence

Antibodies against Kir7.1 protein allow direct visualization of expression in tissue sections or cell cultures . When combined with confocal microscopy, this technique enables precise subcellular localization. For conditional knockout studies, this approach can be multiplexed with antibodies against Cre recombinase to correlate deletion efficiency with phenotypic outcomes .

Tissue-Specific Analysis

For retinal studies, RPE flatmounts stained with phalloidin (to visualize cell boundaries) and antibodies against Kir7.1 provide detailed information about expression patterns and potential mosaicism in conditional knockout models . This approach has revealed critical insights about the relationship between Kcnj13 expression in RPE cells and the survival of adjacent photoreceptors.

Implementing these visualization techniques in combination provides comprehensive data on Kcnj13 expression patterns from the tissue to the subcellular level, facilitating the interpretation of phenotypic outcomes in various experimental models.

What developmental processes critically depend on Kcnj13 function?

Kcnj13 plays essential roles in multiple developmental processes:

Tubulogenesis and Smooth Muscle Development

Kcnj13 is required for proper tracheal tube elongation and morphogenesis, with mutant mice exhibiting significantly shorter tracheas . At the cellular level, Kcnj13 regulates the alignment and polarity of tracheal smooth muscle cells, which is critical for normal tubulogenesis . Similar effects are observed in esophageal development, where Kcnj13 mutations lead to shortened esophageal tubes and disorganized smooth muscle . These processes are active around E11.5-E12.5 in mice, with KCNJ13 expression increasing as smooth muscle tissue develops .

Eye Development

During eye development, Kcnj13 is expressed in the anterior retina and lens primary nuclear fibers at E12.5 . As development progresses, expression becomes restricted to the RPE and ciliary body . This expression pattern is consistent with the essential role of Kcnj13 in maintaining photoreceptor viability through proper RPE function .

Central Nervous System Development

Kcnj13 is expressed in the choroid plexus and ventricular system during brain development . While the precise function in this context remains to be fully elucidated, the expression pattern suggests a potential role in cerebrospinal fluid production or homeostasis .

The developmental requirement for Kcnj13 is underscored by the finding that complete knockout mice exhibit neonatal lethality due to respiratory and palatal defects , highlighting its essential role in organogenesis.

How does Kcnj13 dysfunction lead to retinal degeneration?

Loss of Kcnj13 function triggers a cascade of events leading to progressive retinal degeneration:

Initial Effects on RPE

Disruption of potassium homeostasis in RPE cells impairs their essential supportive functions for photoreceptors . This includes altered membrane potential of RPE cells and compromised transepithelial transport functions. These changes can be detected functionally through alterations in the c-wave of the electroretinogram, which specifically reflects RPE activity .

Secondary Effects on Photoreceptors

Progressive degeneration of photoreceptor outer and inner segments occurs following RPE dysfunction . This eventually leads to complete loss of the outer nuclear layer (ONL) containing photoreceptor cell bodies . The pattern of degeneration strongly suggests that photoreceptors require functional KCNJ13 in the adjacent RPE for survival .

Progressive Nature of Degeneration

Histological analysis of conditional knockout mice with RPE-specific deletion of Kcnj13 reveals a progression of retinal pathology:

StageHistological FindingsFunctional Changes
EarlyDegeneration of photoreceptor inner/outer segmentsReduced ERG a-wave amplitude
IntermediateThinning of the outer nuclear layerFurther decrease in ERG responses
AdvancedComplete loss of outer nuclear layer and outer plexiform layerExtinguished ERG responses
End-stageInner retinal preservation with RPE irregularitiesNon-recordable ERG

Interestingly, in models with mosaic Cre expression, photoreceptor survival directly correlates with the presence of functional Kcnj13 in the underlying RPE cells, demonstrating the local supportive effect of properly functioning RPE on photoreceptor health .

What human diseases are associated with KCNJ13 mutations?

KCNJ13 mutations are associated with several ocular diseases with distinct clinical presentations:

Snowflake Vitreoretinal Degeneration (SVD)

This autosomal dominant disorder is characterized by fibrillar degeneration of the vitreous, corneal guttae, chorioretinal atrophy, and optic nerve head dysmorphism . SVD is caused by specific mutations in KCNJ13 that may result in channels with altered properties, potentially including "leaky" channels that disturb ion homeostasis .

Leber Congenital Amaurosis (LCA)

This severe early-onset retinal dystrophy leads to significant vision loss from an early age. KCNJ13 mutations represent one genetic cause of this clinically and genetically heterogeneous condition . The severe phenotype reflects the critical requirement for proper KCNJ13 function during retinal development.

Autosomal Recessive Retinitis Pigmentosa (arRP)

This progressive degeneration of photoreceptors leads to night blindness and visual field constriction. KCNJ13 mutations can lead to this phenotype through primary RPE dysfunction that secondarily affects photoreceptor survival .

The variety of clinical presentations associated with KCNJ13 mutations highlights the channel's fundamental role in retinal homeostasis and function. The common pathogenic mechanism involves initial dysfunction of the RPE due to impaired potassium transport, followed by secondary degeneration of photoreceptors .

What is the relationship between Kcnj13 function and ion homeostasis?

Kcnj13/Kir7.1 channels are critical regulators of cellular ion homeostasis through several mechanisms:

Membrane Potential Regulation

Kcnj13 contributes to setting the resting membrane potential in various cell types, including smooth muscle and epithelial cells . Inactivation of Kir channels, including Kcnj13, causes membrane depolarization that can be measured using voltage-sensitive dyes like DiBAC₄(3) . In experimental settings, treatment with 50 μM VU590, a KCNJ13 inhibitor, leads to significant membrane depolarization in wild-type tissues, mimicking the effects of genetic mutations .

Downstream Effects on Cytoskeleton

The altered ion homeostasis resulting from Kcnj13 dysfunction has profound effects on cellular architecture:

ParameterNormal Kcnj13Kcnj13 DysfunctionMethod of Assessment
Membrane potentialNormal polarizationDepolarizationDiBAC₄(3) fluorescence
F-actin contentNormal levelsDecreasedPhalloidin staining
Smooth muscle morphologyElongated, alignedDisorganized, polarity defectsImmunofluorescence
AKT phosphorylationNormal levelsAlteredWestern blot

Particularly significant is the finding that membrane depolarization resulting from KCNJ13 dysfunction decreases actin filament formation . This affects cytoskeletal organization, especially in smooth muscle cells, leading to defects in cell alignment and polarity . Interestingly, these cytoskeletal defects can be partially ameliorated by pharmacological increase of AKT phosphorylation, suggesting a mechanistic link between ion transport, signaling cascades, and cytoskeletal regulation .

How do signaling pathways interact with Kcnj13-mediated ion transport?

The relationship between Kcnj13 activity and cellular signaling represents a sophisticated regulatory network:

AKT Signaling Pathway

Research has established a bidirectional relationship between Kcnj13 function and AKT signaling. Kcnj13 activity influences AKT phosphorylation status, while pharmacological enhancement of AKT phosphorylation can partially rescue phenotypes in Kcnj13 mutants . This finding suggests that AKT may be a downstream effector of Kcnj13-mediated changes in membrane potential and ion homeostasis.

In tracheal smooth muscle cells from Kcnj13 mutant mice, researchers observed altered levels of phosphorylated AKT compared to wild-type controls . Treatment with SC79, an AKT activator, ameliorated the tracheal phenotypes in mutant mice, further supporting the functional relationship between these pathways .

Transcriptional Regulation

The Kcnj13 promoter is controlled by AP-1 transcription factors, which respond to various cellular signals including growth factors and stress . This transcriptional regulation provides a mechanism for modulating Kcnj13 expression in response to changing cellular conditions or developmental cues.

For researchers investigating these signaling interactions, important methodological approaches include:

  • Western blotting for phosphorylated and total AKT protein to assess pathway activation

  • Pharmacological inhibitors or activators of specific signaling components

  • Genetic approaches combining Kcnj13 mutations with modifications in signaling pathway components

  • Calcium imaging to assess potential effects on calcium dynamics, which may represent an intermediate mechanism

Understanding these signaling interactions provides critical insights into how ion channel function is integrated with broader cellular processes and may reveal potential therapeutic targets for Kcnj13-related disorders.

What gene therapy approaches show promise for treating Kcnj13-related disorders?

Research into gene therapy for Kcnj13-related disorders has yielded promising preliminary results:

Viral Vector-Based Gene Delivery

Lentiviral vectors carrying the Kcnj13 gene have been tested using two main promoter strategies:

  • EF1a promoter for broad expression

  • VMD2 promoter for RPE-specific expression

These approaches have shown partial rescue of potassium pump activity in the RPE and restoration of the ERG c-wave, which specifically reflects RPE function .

Efficacy Assessment

Researchers have employed multiple complementary approaches to evaluate therapeutic efficacy:

Assessment MethodParameter MeasuredSignificance
Electroretinography (ERG)c-wave amplitudeDirect measure of RPE function
Electroretinography (ERG)a- and b-wave amplitudesIndicates photoreceptor and inner retinal function
HistologyPreservation of retinal layersStructural evidence of protection
ImmunofluorescenceKCNJ13 protein expressionConfirmation of successful gene delivery

Current outcomes demonstrate partial rather than complete rescue, highlighting the need for continued optimization of gene therapy approaches . Key considerations for future research include:

  • Timing of intervention - Early treatment before extensive photoreceptor degeneration may be necessary for optimal outcomes

  • Expression level control - Achieving appropriate KCNJ13 expression levels to avoid potential side effects of overexpression

  • Delivery specificity - Ensuring RPE-specific delivery or expression to minimize off-target effects

  • Vector optimization - Development of improved viral vectors with enhanced tropism for RPE cells

While current approaches provide proof-of-concept for the potential of gene therapy in treating KCNJ13-related retinal disorders, significant optimization is still needed for clinical translation .

How does the unique pore structure of Kcnj13/Kir7.1 influence its functional properties?

KCNJ13/Kir7.1 possesses unique pore properties that distinguish it from other members of the inwardly rectifying potassium channel family . These structural differences underlie its specialized functions in various tissues and influence how mutations affect channel function.

Key distinctive features of KCNJ13/Kir7.1 channels include:

  • Weaker inward rectification compared to many other Kir channels

  • Different sensitivity to intracellular blocking molecules like magnesium and polyamines

  • Unique single-channel conductance properties

  • Distinct responses to changes in extracellular potassium concentration

The structural basis for these properties resides in specific amino acid residues in the pore-forming region and transmembrane domains. These residues determine ion selectivity, conductance, and rectification properties. Mutations in these regions can alter channel function, potentially leading to disease states.

For researchers investigating the structure-function relationship of KCNJ13, important methodological approaches include:

  • Site-directed mutagenesis to modify specific residues and assess functional consequences

  • Electrophysiological characterization using patch-clamp techniques to measure altered channel properties

  • Structural biology methods including X-ray crystallography or cryo-electron microscopy to visualize channel architecture

  • Computational modeling of ion permeation and channel gating to predict the effects of specific mutations

Understanding these structure-function relationships provides critical insights for developing targeted therapeutic approaches for KCNJ13-related disorders.

What methodological approaches are most effective for studying Kcnj13 in organ cultures?

Studying Kcnj13 function in organ cultures provides a valuable intermediate between cell culture and in vivo models, maintaining tissue architecture while allowing experimental manipulation:

Tracheal Explant Cultures

Explanted tracheas from embryonic mice can be maintained in culture to study tubulogenesis and smooth muscle development . This approach allows:

  • Live imaging of developing tissues

  • Pharmacological manipulation of Kcnj13 function using inhibitors like VU590

  • Assessment of smooth muscle alignment and polarity

  • Measurement of tracheal elongation over time

Retinal Explant Cultures

Retinal explants maintain the complex cellular architecture of the retina and allow:

  • Study of RPE-photoreceptor interactions

  • Testing of viral vectors for gene therapy

  • Evaluation of neuroprotective agents

  • Time-course analysis of degeneration processes

Methodological Considerations

When establishing organ culture systems, researchers should carefully consider:

  • Culture medium composition - Supplement selection to support tissue-specific requirements

  • Duration optimization - Determining appropriate culture periods for specific experimental endpoints

  • Pharmacological approaches - Using channel blockers (VU590), signaling modulators (SC79 for AKT activation), or cytoskeletal disruptors

  • Imaging methods - Live imaging with appropriate reporters or fixed tissue analysis with immunostaining

  • Functional assessments - Measuring tissue-specific functions such as ciliary beating in tracheal cultures or photoreceptor responses in retinal cultures

These organ culture approaches bridge the gap between simplified cell culture systems and complex in vivo models, enabling detailed mechanistic studies of Kcnj13 function in a physiologically relevant context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.