Recombinant Rat Inward rectifier potassium channel 4 (Kcnj4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcnj4; Irk3; Inward rectifier potassium channel 4; BIR11; Brain inwardly rectifying K(+ channel 2; Inward rectifier K(+ channel Kir2.3; IRK-3; Potassium channel, inwardly rectifying subfamily J member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnj4
Target Protein Sequence
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM IFSAAFLVSWLFFGLLFWCIAFFHGDLEPSPSGPTAGGPGGNGGGAAPTAAKPCIMHVNG FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMPRPKK RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEETGIIRMLEFG SHLDLERMQAATLPLDNISYRRESAI
Uniprot No.

Target Background

Function
Inward rectifier potassium channels (Kir) are characterized by a preferential inward potassium flux. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation range towards more positive voltages. Inward rectification primarily results from intracellular magnesium block. These channels are inhibited by extracellular barium and cesium.
Gene References Into Functions
  1. Kir2.3 channel downregulation contributes to temporal lobe epilepsy pathogenesis. PMID: 23561319
  2. Immunohistochemical analysis shows Kir2.1, Kir2.2, and Kir2.3/Kcnj4 expression in spontaneously bursting neurons regulating pacemaker activity in the developing superficial dorsal horn. PMID: 23426663
  3. Research indicates novel roles of Kir2.3 in Parkinson's disease (PD) cell models, suggesting common mechanisms underlying various neurodegenerative conditions. PMID: 18619942
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ4 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in kidney distal convoluted tubules (at protein level). Widely expressed throughout the brain. Also found in some peripheral tissues.

Q&A

What is Kcnj4 and what is its functional significance compared to other Kir channel subtypes?

Kcnj4 (also known as Kir2.3, IRK3, HIRK2) is a member of the inwardly rectifying potassium channel family that displays distinctive properties. Unlike voltage-gated potassium channels activated by depolarization, Kcnj4 belongs to a class that demonstrates strong inward rectification, allowing greater potassium flow into rather than out of the cell . This asymmetry in ion conductance is critical for regulating excitability in muscle cells and neurons .

Compared to other family members, Kcnj4 has smaller unitary conductance . It contributes to resting membrane potential maintenance and is characterized by inactivation and activation at voltages greater or less than the potassium equilibrium potential (EK), respectively . The channel's primary role lies in the regulation of cellular excitability and potassium homeostasis in the nervous system and various peripheral tissues .

What is the expression pattern of Kcnj4 in rat tissues?

Kcnj4 shows tissue-specific expression that is particularly prominent in both the heart and brain of rats. Within the brain, expression is especially concentrated in the forebrain region . At the cellular level, Kcnj4 is predominantly localized at postsynaptic membranes of excitatory synapses .

In the gastrointestinal system, Kcnj4 is expressed in interstitial cells of Cajal (ICC) from murine colonic muscles, alongside several other Kir channel subtypes including Kcnj2 (Kir2.1), Kcnj14 (Kir2.4), Kcnj5 (Kir3.4), Kcnj8 (Kir6.1), and Kcnj11 (Kir6.2) . This expression pattern suggests an important role in regulating gastrointestinal motility.

Furthermore, Kcnj4 has been documented in cardiac myocytes, where it participates in cardiac classical inward rectifier potassium currents (IK1) in neonatal rat cardiomyocytes .

What is the molecular structure of rat Kcnj4?

The rat Kcnj4 protein consists of 446 amino acids and is located on chromosome 7q34 . Like other members of the Kir2 subfamily, Kcnj4 forms tetramers to create functional inwardly rectifying channels. Each monomer contains:

  • Two transmembrane helix domains (M1 and M2)

  • An ion-selective P-loop between M1 and M2

  • Cytoplasmic N- and C-terminal domains

This structural arrangement facilitates the channel's strong inward rectification properties and allows regulation by various cellular factors. The rat Kcnj4 amino acid sequence exhibits high conservation with human and mouse orthologs, though with specific differences that can affect functional properties and pharmacological responses .

What electrophysiological approaches are recommended for studying Kcnj4 channel activity?

The whole-cell voltage clamp technique is particularly effective for studying Kcnj4 channel activity. Based on established protocols, the following methodological approach is recommended:

  • Cell Preparation:

    • Dialyze cells with K⁺-rich solution

    • Maintain holding potential at -80 mV

    • Use ramp depolarizations from -140 mV to +40 mV to measure reversal potentials

  • Experimental Protocol:

    • Manipulate external K⁺ concentration ([K⁺]ₒ) to observe changes in inward current

    • Typical K⁺ concentrations: 5 mM (baseline), 60 mM, and 135 mM

    • Record shifts in whole-cell reversal potentials in response to changing [K⁺]ₒ

    • Apply specific Kir channel blockers such as Ba²⁺ (10 μM) or ML-133 (10 μM) to confirm channel identity

  • Data Analysis:

    • Analyze current-voltage relationships

    • Determine reversal potentials at different [K⁺]ₒ conditions

    • Quantify inward rectification properties

In published studies, whole-cell reversal potentials typically shift from approximately -79 ± 2 mV at 5 mM [K⁺]ₒ to -18 ± 1 mV and 1.3 ± 1.2 mV at 60 mM and 135 mM [K⁺]ₒ, respectively .

How can I differentiate Kcnj4 activity from other Kir channel subtypes?

Differentiating Kcnj4 activity from other Kir channel subtypes requires a combination of electrophysiological, pharmacological, and molecular approaches:

  • Electrophysiological Fingerprinting:

    • Characterize the unitary conductance (Kcnj4 has smaller conductance compared to other family members)

    • Analyze rectification properties (strength varies among subtypes)

    • Measure voltage-dependent activation and inactivation kinetics

  • Pharmacological Profiling:

    • Compare sensitivity to common Kir blockers like Ba²⁺ and ML-133

    • Test response to modulating factors that may differentially affect Kir subtypes

  • Molecular Approaches:

    • Employ siRNA or shRNA to selectively knock down Kcnj4 expression

    • Use subtype-specific antibodies for immunocytochemistry or western blotting

    • Perform RT-PCR or qPCR to quantify expression levels of various Kir subtypes

  • Expression Systems:

    • Express recombinant Kcnj4 in systems lacking endogenous Kir channels

    • Create chimeric channels or site-directed mutants to identify critical functional domains

Of particular note, Kir2 channels (including Kcnj4) exhibit distinctive inward rectification properties and Ba²⁺ sensitivity that can help distinguish them from other Kir family members like G-protein regulated Kir3 channels or ATP-sensitive Kir6 channels .

What quality control measures should be applied when working with recombinant Rat Kcnj4?

When working with recombinant Rat Kcnj4 proteins, implementing stringent quality control measures is essential:

  • Protein Purity Assessment:

    • Verify protein purity using SDS-PAGE (target ≥85% purity)

    • Conduct mass spectrometry to confirm protein identity

    • Use size exclusion chromatography to assess protein homogeneity

  • Functional Validation:

    • Perform electrophysiological recordings to confirm channel functionality

    • Validate appropriate inward rectification properties

    • Verify expected pharmacological responses to known blockers

  • Storage and Stability:

    • Maintain in appropriate buffer conditions (typically containing glycerol)

    • Store at -20°C for short-term or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles (limit to one week at 4°C for working aliquots)

Commercial recombinant Kcnj4 proteins are typically available with specified purity levels (≥85% as determined by SDS-PAGE) and host expression systems (e.g., E. coli, yeast, baculovirus, or mammalian cells) .

How can Kcnj4 function be studied in the context of neurological disorders?

Studying Kcnj4 function in neurological disorders requires a multidisciplinary approach:

  • Disease Model Selection:

    • Utilize established rat models of neurological conditions like Parkinson's disease

    • Evidence suggests Kcnj4 may have therapeutic relevance in Parkinson's disease and nerve degeneration

  • Experimental Approaches:

    • Measure Kcnj4 expression levels in affected brain regions using qPCR and western blotting

    • Perform electrophysiological recordings to assess changes in channel function in disease models

    • Conduct immunohistochemistry to examine alterations in subcellular localization

    • Employ calcium imaging to correlate Kcnj4 activity with neuronal excitability

  • Therapeutic Intervention Studies:

    • Test effects of Kcnj4 modulators on disease progression

    • Use viral vectors for region-specific manipulation of Kcnj4 expression

    • Combine electrophysiological recordings with behavioral assessments

  • Molecular Mechanisms Investigation:

    • Explore interactions between Kcnj4 and proteins implicated in neurological disorders

    • Investigate the impact of oxidative stress and mitochondrial dysfunction on channel function

Disease associations data from CTD (Comparative Toxicogenomics Database) has indicated that Kcnj4 in rat models has been linked to several conditions:

DiseaseEvidence TypeReference ID
Parkinson's diseaseTherapeuticPMID:18619942
Nerve DegenerationTherapeuticPMID:18619942
Lung adenocarcinomaMarker/mechanismPMID:30512237

Table 1: Disease associations of rat Kcnj4 based on CTD database

What is the role of Kcnj4 in interstitial cells of Cajal (ICC) and gastrointestinal function?

Kcnj4 expression in interstitial cells of Cajal (ICC) suggests an important role in regulating gastrointestinal motility:

  • Expression Profile:

    • ICC can be isolated and purified using fluorescence-activated cell sorting (FACS)

    • Transcripts of Kcnj4 (Kir2.3) along with other Kir family members have been detected in colonic ICC

  • Functional Characterization:

    • Whole-cell patch-clamp recordings reveal a conductance consistent with Kir2 channels in ICC but not in smooth muscle cells (SMC)

    • Kir2 channels in ICC are activated by elevated extracellular K⁺ and blocked by Ba²⁺ and ML-133

    • Despite expression of gene transcripts, G-protein gated K⁺ channel (Kir3) and KATP (Kir6) currents were not resolved in ICC, indicating selective functional expression

  • Physiological Significance:

    • Kir2 antagonists cause depolarization of freshly dispersed ICC and colonic smooth muscles

    • This suggests that Kcnj4 and other Kir2 family channels are active under resting conditions in colonic muscles

    • The presence of functional Kir2 channels in ICC but not SMC highlights the importance of ICC in regulating the excitability of the GI muscle syncytium

These findings emphasize that when studying ICC-specific roles of Kcnj4, it's crucial to use cell-specific isolation techniques and to correlate channel activity with the spontaneous pacemaker activity characteristic of ICC.

How do experimental design problems affect Kcnj4 research outcomes?

Proper experimental design is critical for obtaining reliable results in Kcnj4 research:

  • Common Design Problems:

    • Lack of randomization with respect to phenotypes of interest can lead to spurious associations

    • Poor plating or experimental order management introduces confounding factors

    • Batch effects when combining multiple experiments can create artificial associations

  • Impact on Research:

    • Studies suggest that approximately 95% of analyzed genetic studies had major problems with experimental design

    • These issues can make it impossible to distinguish real associations from experimental artifacts

    • A prominent example is the Wellcome Trust Case Control Consortium study, where genotyping for control populations and disease studies was performed on distinct sets of plates, potentially introducing batch-related confounding

  • Mitigation Strategies:

    • Implement proper randomization of samples across experimental conditions

    • Include appropriate controls in each experimental batch

    • Consider batch correction methods during data analysis

    • Verify findings using multiple independent experimental approaches

  • Special Considerations for Kcnj4:

    • When comparing wild-type and mutant Kcnj4 channels, ensure identical expression systems and recording conditions

    • For tissue-specific studies, collect and process all tissue types simultaneously under identical conditions

    • Include internal standards across experimental batches to allow for normalization

Awareness of these experimental design considerations is particularly important when studying subtle functional differences in channel variants or when attempting to correlate Kcnj4 activity with disease phenotypes.

How can I resolve discrepancies between mRNA expression and functional activity of Kcnj4 channels?

Discrepancies between Kcnj4 mRNA expression and functional activity are common challenges in ion channel research:

  • Comprehensive Expression Analysis:

    • Confirm mRNA expression using multiple techniques (RT-PCR, qPCR, RNA-seq)

    • Verify protein expression through western blotting, immunocytochemistry, and mass spectrometry

    • Compare expression levels across different preparations and conditions

  • Post-Transcriptional Regulation Assessment:

    • Investigate microRNA-mediated regulation of Kcnj4 expression

    • Examine mRNA stability and alternative splicing

    • Assess translation efficiency using polysome profiling

  • Functional Validation Strategies:

    • Employ multiple electrophysiological techniques (patch-clamp, voltage-sensitive dyes)

    • Use specific pharmacological tools to isolate Kcnj4 currents

    • Complement electrophysiology with fluorescence-based flux assays

  • Heteromeric Channel Considerations:

    • Investigate potential assembly with other Kir subunits that might modify channel properties

    • Express various subunit combinations in heterologous systems

This approach is particularly relevant based on observations in ICC, where despite detecting Kcnj5 (Kir3.4) and Kcnj8/11 (Kir6.1/6.2) transcripts, functional G-protein gated K⁺ channels and KATP currents were not resolved, while Kir2-type currents were clearly detectable .

What controls should be included when designing experiments to study Kcnj4 regulation by signaling pathways?

When studying Kcnj4 regulation by intracellular signaling pathways, include these critical controls:

  • Pathway Validation Controls:

    • Positive controls demonstrating pathway activation (e.g., phosphorylation of known targets)

    • Negative controls using pathway inhibitors or dominant-negative constructs

    • Concentration-response relationships for all pharmacological tools

  • Channel-Specific Controls:

    • Kcnj4 mutants lacking putative regulatory sites

    • Channel expression level verification before and after pathway manipulation

    • Comparison with other Kir channels that should or should not respond to the pathway

  • System-Specific Controls:

    • Background current measurements in non-transfected cells

    • Verification of recording stability throughout the experiment

    • Accounting for time-dependent drift in channel properties

  • Data Analysis Controls:

    • Blinded analysis of electrophysiological recordings

    • Statistical tests appropriate for the experimental design

    • Multiple independent experimental replicates

Inclusion of these controls helps establish whether observed effects on Kcnj4 are specific or represent generalized changes in cell physiology or recording conditions.

How can inconsistencies in pharmacological responses of recombinant versus native Kcnj4 channels be addressed?

Differences in pharmacological responses between recombinant and native Kcnj4 channels can arise from multiple factors:

  • Expression System Influences:

    • Different membrane lipid compositions can alter channel-drug interactions

    • Absence of regulatory proteins or subunits in heterologous systems

    • Variations in post-translational modifications

  • Investigation Strategies:

    • Compare responses in multiple expression systems (Xenopus oocytes, HEK293, CHO cells)

    • Reconstitute suspected accessory proteins or regulatory factors

    • Examine the impact of membrane cholesterol content and other lipid components

  • Technical Approaches:

    • Use identical recording solutions and conditions for native and recombinant channels

    • Apply the same drug application protocols and equilibration times

    • Construct full concentration-response curves rather than single-concentration comparisons

  • Physiological Context:

    • Consider tissue-specific factors that may influence drug access or efficacy

    • Assess channel behavior under various physiological states (pH changes, oxidative conditions)

    • Evaluate potential interactions with endogenous modulators

These considerations are particularly important when using recombinant Kcnj4 as a model for predicting in vivo drug responses or when developing channel-targeted therapeutics for conditions like Parkinson's disease, where Kcnj4 has been implicated .

What emerging technologies show promise for advancing Kcnj4 research?

Several cutting-edge technologies are likely to transform future Kcnj4 research:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for high-resolution Kcnj4 structure determination

    • Single-particle analysis to capture different functional states

    • Molecular dynamics simulations to model ion permeation and drug interactions

  • Gene Editing Technologies:

    • CRISPR-Cas9 for generating precise Kcnj4 mutations in cellular and animal models

    • Base editing for introducing specific amino acid substitutions

    • Conditional knockout models for tissue-specific Kcnj4 deletion

  • Advanced Imaging Methods:

    • Super-resolution microscopy for visualizing channel clustering and localization

    • Optogenetic tools for precise temporal control of channel activity

    • Genetically encoded voltage indicators for non-invasive monitoring of cellular excitability

  • Computational Approaches:

    • Machine learning for predicting channel-drug interactions

    • Systems biology to integrate Kcnj4 function within broader signaling networks

    • In silico screening of novel Kcnj4 modulators

These technologies will enable researchers to explore Kcnj4 biology with unprecedented precision and place channel function in a broader physiological context.

What are the most promising therapeutic applications targeting Kcnj4 channels?

Based on current evidence, several therapeutic directions involving Kcnj4 show promise:

  • Neurological Disorders:

    • Targeting Kcnj4 for Parkinson's disease treatment, supported by evidence from rat models

    • Potential applications in nerve degeneration disorders

    • Modulation of neuronal excitability in epilepsy models

  • Cardiac Arrhythmias:

    • Regulation of IK1 currents in cardiomyocytes to control heart rhythm

    • Atrial-specific Kcnj4 modulation for atrial fibrillation

    • Exploration of chamber-specific channel expression patterns

  • Gastrointestinal Motility Disorders:

    • Targeting Kcnj4 in ICC to regulate intestinal pacemaker activity

    • Potential applications in functional gastrointestinal disorders

    • Combination approaches targeting multiple channel types in the GI tract

  • Cancer:

    • Investigation of Kcnj4's role in lung adenocarcinoma progression

    • Exploration of channel-targeted approaches for cancer treatment

    • Biomarker applications based on altered channel expression

Development of subtype-selective Kir channel modulators remains a critical challenge for translating these potential applications into clinical therapies.

Human Protein Atlas data indicates differential expression patterns of KCNJ4 across tissues, which may inform tissue-specific therapeutic strategies and help predict potential side effects of systemic Kcnj4 modulation .

How can experimental design be improved to avoid common pitfalls in Kcnj4 research?

To ensure robust and reproducible results in Kcnj4 research, implement these best practices:

  • Sample Randomization:

    • Randomize samples with respect to phenotypes of interest

    • Distribute experimental and control samples across plates and experimental days

    • Document randomization procedures thoroughly

  • Batch Effect Management:

    • Include technical replicates across batches

    • Process matched controls simultaneously with experimental samples

    • Implement batch correction during data analysis

  • Standardized Protocols:

    • Establish and follow detailed standard operating procedures

    • Maintain consistent reagent sources and preparation methods

    • Document all experimental parameters comprehensively

  • Rigorous Controls:

    • Include positive and negative controls in each experiment

    • Verify antibody specificity using knockout models or blocking peptides

    • Perform complementary assays to validate key findings

  • Statistical Considerations:

    • Determine appropriate sample sizes through power analysis

    • Select statistical tests appropriate for data distribution

    • Consider multiple testing correction for large-scale analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.