Recombinant Rat Keratinocyte-associated protein 2 (Krtcap2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Rat Keratinocyte-associated protein 2 (Krtcap2) is a protein associated with keratinocytes, with the short name KCP-2 . Krtcap2 is found in Rattus norvegicus (Rat) . Research suggests that Krtcap2 is involved in biological functions such as cell recognition, immune response, and signal transduction .

Basic Information

PropertyValue
UniProt NumberB2RZC9
Gene ID200185
Protein LengthPartial
Immunogen SpeciesRattus norvegicus (Rat)
Purity>85% (SDS-PAGE)
SourceYeast
Target NamesKrtcap2
Other NamesKeratinocyte-associated protein 2, KCP-2
Gene NameKRTCAP2 (Keratinocyte Associated Protein 2)

Role in Gout Pathogenesis

Recent studies indicate a potential association between KRTCAP2 expression and gout . An increased expression of KRTCAP2 is associated with an elevated risk of gout . Specifically, KRTCAP2, situated on human chromosome 1q22, encodes a protein involved in glycosylation, which can impact immune responses . It is suggested that KRTCAP2 may influence urate production and clearance by altering the expression and function of xanthine oxidoreductase (XOR) .

4.2. SMR Analysis Results

In SMR analysis, 15,679 probes in the eQTLGen blood data were found to be associated with gout. Among these, 14 genes, including KRTCAP2, showed pleiotropic or potential causal relationships with gout .

4.3. GO Enrichment Analysis

GO enrichment analysis has identified several biological processes, cellular components, and molecular functions related to differentially expressed genes, including KRTCAP2 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Krtcap2; Keratinocyte-associated protein 2; KCP-2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Krtcap2
Target Protein Sequence
MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA PALTPAKVTGKSKKRN
Uniprot No.

Target Background

Function

Recombinant Rat Keratinocyte-associated protein 2 (Krtcap2) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the OST complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All OST subunits are required for maximal enzyme activity. Krtcap2 may be involved in N-glycosylation of APP (amyloid-beta precursor protein) and can modulate gamma-secretase cleavage of APP by enhancing PSEN1 endoproteolysis.

Database Links
Protein Families
KRTCAP2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Rat Keratinocyte-associated Protein 2 (Krtcap2) and what are its primary functions?

Rat Keratinocyte-associated protein 2 (Krtcap2) is a subunit of the oligosaccharyl transferase (OST) complex that plays a critical role in protein N-glycosylation. The OST complex catalyzes the initial transfer of a defined glycan (Glc₃Man₉GlcNAc₂ in eukaryotes) from lipid carrier dolichol-pyrophosphate to asparagine residues within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains .

This process occurs cotranslationally as the OST complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits of the complex, including Krtcap2, are required for maximal enzymatic activity .

What detection methods are most effective for analyzing Krtcap2 expression in rat tissue samples?

Several complementary approaches provide optimal detection of Krtcap2 in rat tissue samples:

  • Western Blot Analysis: Rabbit polyclonal antibodies against Krtcap2 have been validated for detecting endogenous levels of Krtcap2 in human, mouse, and rat samples . The recommended dilution range for Western blot is 1:500-2000 .

  • ELISA: Rat Keratinocyte-Associated Protein 2 ELISA kits are available for the in vitro quantitative measurement of Krtcap2 in tissue homogenates, cell lysates, and other biological fluids with a typical test range of 0.156 ng/ml - 10 ng/ml .

  • Immunohistochemistry: Some antibodies have been validated for immunohistochemistry on paraffin-embedded tissues (IHC-P) .

For optimal detection sensitivity and specificity, researchers should consider using multiple detection methods and validated antibodies specific to rat Krtcap2.

What expression systems are available for producing recombinant Rat Krtcap2?

Multiple expression systems are available for producing recombinant Rat Krtcap2, each with specific advantages:

Expression SystemSourceProduct FeaturesApplications
E. coliBacterialStandard recombinant proteinWestern blot, ELISA
E. coli with Avi-tagBacterialBiotinylated in vivo by AviTag-BirA technologyProtein interaction studies, pull-down assays
YeastEukaryoticPost-translational modificationsFunctional studies
BaculovirusInsect cellsHigher eukaryotic processingComplex structural studies
Mammalian cellsHEK-293 cellsNative-like folding and modificationsFunctional assays, antibody production

The choice of expression system should depend on experimental requirements, particularly regarding post-translational modifications and protein folding needs.

How does Krtcap2 contribute to the N-glycosylation process and what are the experimental considerations for studying this function?

Krtcap2 functions as an essential subunit of the oligosaccharyltransferase (OST) complex. When designing experiments to study its role in N-glycosylation, researchers should consider:

  • Experimental Models: Work by Kelleher et al. (2012) identified Krtcap2 as a bona fide subunit of the mammalian oligosaccharyltransferase . This study demonstrated that all subunits, including Krtcap2, are required for maximal enzymatic activity.

  • Functional Assessment: Researchers can evaluate Krtcap2's contribution to N-glycosylation by:

    • Monitoring glycosylation changes after Krtcap2 knockdown/overexpression

    • Assessing interactions with other OST complex components

    • Measuring oligosaccharyltransferase activity with recombinant proteins

  • Associated Pathways: Studies should account for Krtcap2's potential involvement in modulating gamma-secretase cleavage of amyloid precursor protein (APP) by enhancing endoproteolysis of PSEN1 .

When interpreting experimental results, researchers should note that Krtcap2 functions in a complex with multiple proteins, so isolated effects may be difficult to attribute solely to Krtcap2.

What are the optimal transfection methods for Krtcap2 overexpression studies in rat cell lines?

For successful Krtcap2 overexpression in rat cell lines, consider these methodological approaches:

  • Viral Vector Systems: Adeno-associated viral (AAV) vectors have been successfully used for Krtcap2 expression. These ready-to-use AAV systems can directly overexpress Krtcap2 in a wide range of cell types . Key considerations include:

    • Serotype selection is critical for transduction efficiency in specific rat cell lines

    • CMV promoter-driven constructs show robust expression in most cell types

    • Expression can be monitored from 48 hours up to 5 days after infection

  • Plasmid Transfection: When using plasmid-based approaches:

    • For rat cell lines, lipid-based transfection reagents typically yield 30-60% transfection efficiency

    • Electroporation can achieve higher efficiency (60-80%) in difficult-to-transfect rat cells

    • Cell density at transfection should be optimized (typically 70-80% confluence)

  • Expression Verification: Western blot using anti-Krtcap2 antibodies at 1:500-2000 dilution is recommended for confirming successful overexpression .

How does the expression and function of Krtcap2 compare between different rat tissues and developmental stages?

Research on tissue-specific and developmental expression of Krtcap2 reveals:

  • Tissue Distribution: While comprehensive tissue distribution data specifically for Krtcap2 is limited, related studies on keratinocyte growth factors in rats demonstrate that expression patterns can vary significantly between tissue types. For example:

    • Clara cells in rat airway epithelial cells respond to keratinocyte growth factors by proliferation and changes in protein expression

    • Different cell types within the same tissue demonstrate varied responses to keratinocyte-associated factors

  • Developmental Considerations: When studying Krtcap2 across developmental stages:

    • Consider age-dependent variations in expression

    • Account for proliferation dynamics, as observed in studies showing peak proliferation at days 1-2 following stimulation with keratinocyte growth factors in rat models

    • Monitor phenotypic alterations that may accompany changes in Krtcap2 expression, similar to the transient phenotypic changes observed with other keratinocyte-associated proteins

  • Methodological Approaches: Effective characterization requires:

    • Immunohistochemistry (IHC) in conjunction with stereology for quantitative assessment

    • Double immunofluorescence labeling to differentiate cell-specific responses

    • Monitoring both proliferation markers (e.g., Ki-67, BrdU incorporation) and protein expression changes

What are the considerations for using recombinant Rat Krtcap2 in protein interaction studies?

When utilizing recombinant Rat Krtcap2 for protein interaction studies:

  • Protein Quality Considerations:

    • Expression system selection significantly impacts protein structure and function

    • For interaction studies, mammalian or insect cell-derived Krtcap2 may preserve critical post-translational modifications

    • Biotinylated variants using Avi-tag technology enable directional coupling to streptavidin surfaces

  • Experimental Design:

    • Pull-down assays: Use recombinant Krtcap2 as bait to identify interaction partners

    • Surface Plasmon Resonance: Measure binding kinetics with purified potential interactors

    • Co-immunoprecipitation: Validate interactions in cellular contexts

  • Control Experiments:

    • Include non-specific protein controls to account for non-specific binding

    • Perform binding assays under varying salt and detergent conditions to distinguish specific from non-specific interactions

    • Validate interactions with mutated versions of Krtcap2 to identify critical binding domains

  • Storage and Stability:

    • Recombinant Krtcap2 proteins should be stored at -20°C

    • Avoid repeated freeze-thaw cycles to maintain protein integrity

    • For long-term studies, aliquot proteins and use fresh aliquots for each experiment

What are the common challenges in working with recombinant Rat Krtcap2 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant Rat Krtcap2:

  • Protein Solubility Issues:

    • Challenge: Recombinant Krtcap2 may form aggregates or show limited solubility

    • Solution: Consider using fusion tags (His, GST, MBP) to enhance solubility

    • Alternative: Explore different buffer conditions with varying pH and salt concentrations

  • Expression Yield Variability:

    • Different expression systems produce varying yields of functional protein

    • E. coli-derived rat DHFR gene expression has shown high enzymatic activity , suggesting similar approaches might work for Krtcap2

    • For challenging proteins, baculovirus or mammalian expression systems may provide better yields of properly folded protein

  • Activity Assessment:

    • Challenge: Verifying functional activity of recombinant Krtcap2

    • Solution: Develop oligosaccharyltransferase activity assays with defined substrates

    • Alternative: Assess protein-protein interactions with known OST complex components

How can researchers verify the structural integrity and functional activity of purified recombinant Rat Krtcap2?

To ensure recombinant Rat Krtcap2 maintains proper structure and function:

  • Structural Integrity Assessment:

    • Circular Dichroism (CD) spectroscopy to analyze secondary structure

    • Size Exclusion Chromatography (SEC) to verify monodispersity and proper folding

    • Dynamic Light Scattering (DLS) to detect aggregation

  • Functional Validation:

    • Glycosylation assays using synthetic peptide substrates containing N-X-S/T motifs

    • Co-immunoprecipitation with other OST complex components

    • Integration into reconstituted membranes to assess complex formation capability

  • Quality Control Metrics:

    • Purity assessment via SDS-PAGE (>90% purity recommended)

    • Mass spectrometry to confirm protein identity and detect modifications

    • Endotoxin testing for in vivo applications (<1 EU/mg protein)

What are the experimental considerations when comparing rat Krtcap2 with human KRTCAP2 in cross-species studies?

When conducting cross-species comparisons between rat Krtcap2 and human KRTCAP2:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.