Recombinant Rat Kidney mitochondrial carrier protein 1 (Slc25a30)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
Slc25a30; Kmcp1; Kidney mitochondrial carrier protein 1; Solute carrier family 25 member 30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a30
Target Protein Sequence
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIG REEGLRALYSGIAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLINVVCGILSGVIS SAIANPTDVLKIRMQAQNSAVQGGMIGNFISIYQQEGTRGLWKGVSLTAQRAAIVVGVEL PVYDITKKHLILSGLMGDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCS GYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL
Uniprot No.

Target Background

Function
Probable transporter.
Database Links

KEGG: rno:361074

UniGene: Rn.19440

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Slc25a30 in rat kidney mitochondria?

Slc25a30, as a member of the mitochondrial carrier protein family, likely functions primarily in the transport of specific metabolites across the inner mitochondrial membrane. While specific substrates for Slc25a30 are not explicitly mentioned in current research, we can infer from the general function of SLC25 family members that it may be involved in transporting fatty acids, amino acids, carboxylic acids, inorganic ions, or other metabolic products . The primary mechanism likely involves providing a pathway linking cytoplasmic solutes with the mitochondrial matrix, thereby influencing the distribution and concentration of transported substrates and affecting mitochondrial energy metabolism .

How does Slc25a30 structurally compare to other characterized SLC25 family members?

Like other members of the SLC25 family, Slc25a30 likely features a three-domain structure with six transmembrane α-helices and a characteristic 3-fold repeated motif of hydrophobic and charged residues . This structural symmetry serves as the foundation for analogous transport channels. Methodologically, researchers can use comparative structural biology approaches, including sequence alignment with well-characterized family members such as SLC25A4 (ANT1) and SLC25A5 (ANT2), to predict functional domains and critical residues within Slc25a30 . X-ray crystallography or cryo-electron microscopy would be necessary to definitively resolve the protein's structure.

What is the expression pattern of Slc25a30 in different rat tissues?

While specific expression data for Slc25a30 is not provided in the available research, methodological approaches to determine this would include quantitative PCR, western blotting, and immunohistochemistry across multiple rat tissues. By comparison, some SLC25 family members show tissue-specific expression patterns—for example, SLC25A37 is predominantly expressed in red blood cells while SLC25A28 has a broader distribution109. For Slc25a30, researchers should examine expression levels across various tissues including kidney, liver, heart, brain, and skeletal muscle to establish its tissue distribution profile and identify potential tissue-specific functions.

What are the specific substrate transport properties of Slc25a30 and how do they differ from other mitochondrial carriers?

Determining the specific substrates of Slc25a30 requires systematic transport assays using reconstituted protein in liposomes. Methodologically, researchers should express recombinant Slc25a30 in systems such as bacterial or yeast expression systems, purify the protein, and reconstitute it into liposomes loaded with potential substrates. Transport activity can be measured by substrate uptake or exchange assays using radiolabeled compounds. Based on the diverse functions of SLC25 family members, candidate substrates might include nucleotides (like SLC25A4-A5), amino acids (like SLC25A12-13), dicarboxylates (like SLC25A11), fatty acids (like SLC25A20), iron ions (like SLC25A37-28), or vitamins (like SLC25A19) . The results of these assays would help position Slc25a30 within the functional classification of the SLC25 family.

How do post-translational modifications regulate Slc25a30 function in different metabolic states?

Post-translational modifications likely play critical roles in regulating Slc25a30 function. Methodologically, researchers should use mass spectrometry-based proteomics to identify phosphorylation, acetylation, ubiquitination, or other modifications under various metabolic conditions. For example, calcium-dependent regulation might be important, as seen with SLC25A24 and SLC25A23, which mediate calcium buffering capacity in mitochondria . Site-directed mutagenesis of putative modification sites followed by functional assays would establish the physiological significance of these modifications. Researchers should examine how these modifications change in response to metabolic stressors such as hypoxia, nutrient deprivation, or oxidative stress.

What protein-protein interactions are critical for Slc25a30 function?

To identify protein interactors of Slc25a30, researchers should employ techniques such as co-immunoprecipitation followed by mass spectrometry, yeast two-hybrid screening, or proximity labeling approaches (BioID, APEX). Drawing parallels from other SLC25 family members, potential interactors might include metabolic enzymes, other transporters, or regulatory proteins. For instance, SLC25A28 has been shown to interact with p53 in hepatic stellate cells, forming a complex that enhances its activity and affects iron accumulation115. Validation of identified interactions using techniques like FRET or PLA (Proximity Ligation Assay) would provide spatial information about these interactions within mitochondria.

What are the optimal conditions for expressing and purifying recombinant Slc25a30 for functional studies?

Expression and purification of functional recombinant Slc25a30 presents significant technical challenges due to the hydrophobic nature of membrane proteins. Methodologically, researchers should test multiple expression systems including bacterial (E. coli), yeast (P. pastoris), insect cells (Sf9), or mammalian cells to identify optimal conditions. For bacterial expression, using specialized strains (e.g., C41/C43) and fusion tags (e.g., MBP, SUMO) can improve solubility and folding. Detergent screening is critical—mild detergents like DDM, LMNG, or nanodisc incorporation may preserve protein function. Purification typically involves IMAC (immobilized metal affinity chromatography) followed by size exclusion chromatography. Functional integrity should be assessed using substrate binding assays or reconstitution into proteoliposomes for transport measurements.

What gene editing approaches are most effective for studying Slc25a30 function in rat models?

For in vivo studies of Slc25a30 function, CRISPR-Cas9 technology offers the most precise approach for gene manipulation. Methodologically, researchers should design multiple guide RNAs targeting conserved regions of the Slc25a30 gene, followed by thorough validation of editing efficiency. For conditional models, which are particularly valuable given the potential embryonic lethality of complete knockout (as seen with several SLC25 family members), the Cre-loxP system with tissue-specific promoters (e.g., kidney-specific) should be employed. Alternative approaches include siRNA or shRNA for transient knockdown studies in cell culture models derived from rat kidney. Phenotypic analysis should include mitochondrial function assays (respirometry, membrane potential), metabolite profiling, and tissue-specific functional tests.

What methods are most effective for measuring Slc25a30 transport kinetics and substrate specificity?

To determine transport kinetics and substrate specificity, researchers should use a combination of techniques. Methodologically, this includes:

TechniqueApplicationAdvantagesLimitations
Liposome reconstitutionDirect measurement of transportControlled environment, quantitativeTechnically challenging
Isolated mitochondriaSemi-native transport measurementMaintains mitochondrial environmentBackground from other transporters
Patch-clamp of mitochondrial membranesElectrophysiological propertiesReal-time kinetics, high sensitivityTechnically demanding
Metabolite profiling in knockout modelsPhysiological substrate identificationIn vivo relevanceIndirect measurement
Isotope labeling and flux analysisMetabolic pathway contributionMaps integration with metabolismComplex data interpretation

Researchers should systematically vary substrate concentrations to determine Km and Vmax values, test substrate competition, and examine the effects of pH, membrane potential, and inhibitors on transport activity.

What is the potential role of Slc25a30 in mitochondrial dysfunction associated with kidney disease?

Given its expression in kidney mitochondria, Slc25a30 may play a role in renal pathophysiology. Methodologically, researchers should examine Slc25a30 expression and function in models of acute kidney injury, chronic kidney disease, and diabetic nephropathy. Drawing parallels from other SLC25 family members, dysregulation might contribute to metabolic disturbances, oxidative stress, or apoptotic pathways. For instance, SLC25A4 (ANT1) upregulation suppresses cell proliferation and migration in glioblastoma, while its overexpression induces apoptosis in breast cancer cells. Conversely, SLC25A5 (ANT2) high expression in several cancers is associated with poor prognosis . To investigate Slc25a30's role, researchers should use kidney-specific knockout or overexpression models, coupled with functional assessments of mitochondrial metabolism, ROS production, and cell death pathways.

How does Slc25a30 expression and function change in cancer models compared to normal tissues?

While direct evidence for Slc25a30 in cancer is not available in the provided research, other SLC25 family members show significant associations with various cancers as shown in the comprehensive table from the literature . Methodologically, researchers should compare Slc25a30 expression between normal kidney tissue and renal cell carcinoma samples using qPCR, western blotting, and immunohistochemistry. Functional changes can be assessed through metabolic flux analysis, comparing substrate transport in mitochondria isolated from normal and cancerous tissues. Knocking down or overexpressing Slc25a30 in renal cancer cell lines would help determine its impact on proliferation, apoptosis, and migration. Drawing parallels from SLC25A11's role in non-small cell lung cancer and melanoma or SLC25A13's association with poor prognosis in colorectal cancer, researchers should investigate whether Slc25a30 influences cancer cell metabolism and survival.

What metabolic pathways might be therapeutically targeted based on Slc25a30 function?

Targeting metabolic pathways dependent on Slc25a30 function could provide novel therapeutic approaches. Methodologically, researchers should first definitively establish Slc25a30's substrates and metabolic pathway involvement through the techniques discussed previously. Potential therapeutic strategies might include:

  • Small molecule inhibitors of Slc25a30 transport function

  • Substrate analogs that compete for transport

  • Modulators of Slc25a30 expression

  • Combination therapies targeting complementary metabolic pathways

For example, if Slc25a30 functions similarly to SLC25A10 (DIC), its inhibition might disrupt glutathione metabolism and enhance sensitivity to radiation or chemotherapy by affecting cellular antioxidant capacity. Alternatively, if it functions like SLC25A12/13 (AGCs), targeting it might synergize with therapies affecting aspartate and glutamine metabolism.

How can researchers address contradictory findings regarding Slc25a30 function in different experimental systems?

Contradictory findings are common in complex biological systems. Methodologically, researchers should:

  • Carefully document experimental conditions, including cell types, expression systems, and assay conditions

  • Compare recombinant protein studies with endogenous protein studies

  • Consider tissue-specific effects and potential isoforms

  • Account for compensatory mechanisms in knockout models

  • Use multiple complementary approaches to verify key findings

Similar to contradictions seen with SLC25A4, which inhibits tumor growth in some contexts but promotes gastric cancer proliferation in others, researchers should investigate context-dependent functions of Slc25a30. Meta-analysis of available data and systematic review methodologies may help reconcile apparently contradictory findings.

What bioinformatic approaches best integrate Slc25a30 structure-function relationships with other omics data?

Integrating multiple data types requires sophisticated bioinformatic approaches. Methodologically, researchers should:

  • Use homology modeling to predict Slc25a30 structure based on known structures of SLC25 family members

  • Apply molecular dynamics simulations to understand substrate binding and transport mechanisms

  • Integrate transcriptomic, proteomic, and metabolomic data to identify correlations with Slc25a30 expression

  • Employ machine learning algorithms to identify patterns across diverse datasets

  • Use systems biology approaches to position Slc25a30 within metabolic networks

Network analysis tools can help identify functional relationships between Slc25a30 and other proteins or metabolic pathways, similar to how SLC25A23 has been linked to MLH1 and p53 in diffuse large B-cell lymphoma.

How should researchers design experiments to distinguish between direct and indirect effects of Slc25a30 manipulation?

Distinguishing direct from indirect effects is crucial for accurate interpretation. Methodologically, researchers should:

  • Use acute vs. chronic manipulation strategies (e.g., inducible systems)

  • Perform time-course experiments to establish temporal relationships

  • Implement rescue experiments with wild-type and mutant forms of Slc25a30

  • Use metabolic flux analysis with isotope labeling to track immediate consequences of Slc25a30 disruption

  • Develop in vitro systems with reconstituted components to establish direct biochemical effects

For example, when studying metabolic adaptations to Slc25a30 manipulation, researchers should consider both immediate changes in substrate availability and longer-term transcriptional responses, similar to how SLC25A12 silencing has been linked to G1 cell cycle arrest in HepG2 cells, impacting cell proliferation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.