Recombinant Rat KiSS-1 receptor (Kiss1r)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

Recombinant KISS1R is essential for investigating receptor-ligand dynamics and signaling pathways:

  • Binding Activity: Binds kisspeptin-10 (KP-10) with high affinity, initiating Gq/11-mediated phospholipase C (PLC) activation and intracellular calcium release .

  • Role in Reproduction: Critical for gonadotropin-releasing hormone (GnRH) secretion, as shown by hypogonadism in Kiss1r-knockout rodents .

  • Tumor Suppression: Downregulation of KISS1R in advanced prostate cancer correlates with metastasis, suggesting therapeutic potential .

3.1. Mechanistic Studies

  • Signal Transduction: Used to map kisspeptin-induced calcium flux and IP3/DAG pathways .

  • Ligand-Receptor Interactions: Facilitates structure-function studies of kisspeptin binding domains .

3.2. Disease Models

  • Cancer Research: Reduced KISS1R expression in metastatic prostate cancer tissues highlights its role as a metastasis suppressor .

  • Reproductive Disorders: Administered to model precocious puberty or hypogonadotropic hypogonadism in rodents .

Production and Quality Control

Recombinant KISS1R is produced under stringent conditions:

  • Reconstitution: Lyophilized protein is reconstituted in PBS or ddH2O to 0.1–1.0 mg/ml .

  • Storage: Stable at -80°C for one year; avoid freeze-thaw cycles .

  • Validation: Confirmed via Western blot (WB) and SDS-PAGE for size and purity .

6.1. Reproductive Physiology

  • KISS1R activation triggers GnRH release, initiating puberty in rodents .

  • Exogenous kisspeptin-10 rescues LH secretion in Kiss1r-null mice, confirming receptor indispensability .

6.2. Cancer Biology

  • Metastatic prostate cancer exhibits reduced KISS1R expression, correlating with higher Gleason scores .

  • KISS1R agonists inhibit tumor cell migration in vitro, supporting therapeutic exploration .

Future Directions

  • Therapeutic Targeting: Develop KISS1R agonists/antagonists for infertility or hormone-dependent cancers .

  • Diagnostic Biomarkers: Assess KISS1R expression levels for prostate cancer prognosis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kiss1r; Gpr54; KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; rOT7T175; Kisspeptins receptor; Metastin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAAEATLGPNVSWWAPSNASGCPGCGVNASDGPGSAPRPLDAWLVPLFFAALMLLGLVGN SLVIFVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPTWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALTVSLSIWVGSAAVSAPVLAL HRLSPGPHTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAP TDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYA AYALKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCGPQRQRRPHASAHSDRAAPH SVPHSRAAHPVRVRTPEPGNPVRRSPSVQDEHTAPL
Uniprot No.

Target Background

Function
The Kiss1 receptor (Kiss1r) is a G protein-coupled receptor that binds to metastin, a C-terminally amidated peptide derived from KiSS1. KiSS1 is a metastasis suppressor protein. Activation of Kiss1r inhibits cell proliferation and migration, key aspects of tumor metastasis. The receptor is crucial for normal gonadotropin-releasing hormone (GnRH) physiology and pubertal development. The hypothalamic KiSS1/Kiss1r system plays a pivotal role in the central regulation of the gonadotropic axis during puberty and adulthood. Analysis of the signaling pathways activated by the receptor reveals coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins.
Gene References Into Functions
  1. These data suggest that ovarian Kiss1 and Kiss1r mRNA levels are elevated on postnatal days 20 and 15, respectively, and that alterations in serum LH levels and ovarian sensitivity to LH may be involved in the regulation of ovarian Kiss1 mRNA levels. PMID: 28552864
  2. This study identifies the neurochemical characteristics of approximately 78% of Kiss1r-expressing neurons. PMID: 27981646
  3. Hypogonadism leads to a decrease in kisspeptin signaling in peripheral androgen-dependent tissues. Serum levels of kisspeptins are physiologically low and may not serve as a reliable marker of kisspeptin system activity. The effectiveness of testosterone treatment is limited, highlighting the need for novel therapeutic approaches. PMID: 29244919
  4. GnRH neurons may act as intermediaries in the activation and maintenance of reproductive function regulated by the kisspeptin/kiss1r system. PMID: 27373140
  5. Kiss1R mRNA is expressed in the perinuclear zone-supraoptic nucleus, and its relative expression remains consistent throughout pregnancy. PMID: 27589336
  6. Imbalances in Kiss1/GPR54 may contribute to both reproductive and metabolic abnormalities observed in obese and diabetic rats. PMID: 26853724
  7. This study demonstrates colocalization of Kiss1r and Melanin-concentrating hormone in neurons of the lateral hypothalamus (LH) and zona incerta (ZI). However, MCHR1 mRNA is widely expressed throughout the brain. PMID: 24978951
  8. The presence of Kiss1 and Kiss1r mRNA in the rat placenta is confirmed, with expression increasing during the final third of pregnancy, suggesting a role in regulating placental growth. PMID: 23684378
  9. The kisspeptin/GPR54 signaling system can stimulate progesterone secretion in rat luteal cells through the Erk1/2 mitogen-activated protein kinase signaling pathway. PMID: 23312234
  10. Kisspeptin and its receptor are expressed in the human, rat, and mouse heart, and kisspeptins exhibit potent positive inotropic activity. PMID: 22132116
  11. KISS1 and KISS1R expression is observed in the human and rat carotid body and superior cervical ganglion. PMID: 22193294
  12. Data indicate that expression of kisspeptins and the kisspeptin receptor is altered in the kidney tissues of individuals with chronic renal impairment, suggesting potential pathophysiological roles in chronic renal failure. PMID: 20621140
  13. These findings demonstrate a reduction in Kiss1 at day 25 due to food deprivation at postnatal day 25. Additionally, Kiss1r is reduced by food deprivation on postnatal days 5 and 25. PMID: 20807723
  14. The hypothalamic KiSS-1/GPR54 system is a key regulator of the gonadotropic axis during puberty and adulthood. PMID: 15242985
  15. The KiSS-1/GPR54 system is a novel and essential component of the neuroendocrine network that governs gonadotropin secretion. PMID: 15637288
  16. KiSS-1 mRNA/metastin (kisspeptin-54) expression is suppressed in the arcuate nucleus by suckling. PMID: 17289848
  17. The GnRH receptor/GnRH and GPR54/kisspeptin autoregulatory systems are integrated through negative feedback mechanisms to regulate GnRH and kisspeptin secretion from GnRH neurons. PMID: 17698953
  18. KiSS1 and GPR54 genes are co-expressed in rat gonadotrophs and are differentially regulated in vivo by estradiol and gonadotropin-releasing hormone. PMID: 18208554
  19. KiSS1 expression is upregulated by neuronal activity, and activation of GPR54 by kisspeptin may contribute to maintaining basal BDNF levels essential for hippocampal function. PMID: 18834866
  20. Results suggest that reduced Kiss1-Kiss1r expression may contribute to stress-induced suppression of luteinizing hormone secretion. PMID: 19094090
  21. Data show that kiss1 and GPR54 are expressed in small to large neurons in the L4/5 dorsal root ganglion of naive rats. PMID: 19111911
  22. Data indicate that Kiss1, but not Kiss1r mRNA, in the mPOA is down-regulated in pre-pubertal females. This suggests that this neuronal population plays a crucial role in controlling the onset of puberty and that its function can be affected by neonatal stress. PMID: 19500221

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest expression levels in the cerebrum and cecum. Moderate expression in the ovary, colon and placenta. Low levels in the uterus, small intestine, and thymus. Expressed only moderately in the placenta. No expression in kidney tissues. Has a complex and

Q&A

What is the Rat KiSS-1 receptor (Kiss1r) and what is its primary function in rodent models?

The Rat KiSS-1 receptor (Kiss1r) is a G-protein coupled receptor that serves as the target for kisspeptin, a peptide generated by the metastasis suppressor KiSS-1 gene. This receptor-ligand system plays dual critical roles in rat physiology. First, it functions as a metastasis suppressor, potentially regulating events downstream of cell-matrix adhesion and involving cytoskeletal reorganization . Second, it is essential for normal gonadotropin-releasing hormone physiology and reproductive development. The hypothalamic KiSS1/GPR54 system serves as a pivotal factor in central regulation of the gonadotropic axis during puberty and adulthood . In research contexts, this system has emerged as a key regulatory component of mammalian reproduction, making it valuable for studies of developmental biology, oncology, and reproductive physiology.

How is Kiss1r expression regulated during development in rat reproductive tissues?

Kiss1r expression follows specific developmental patterns in rat reproductive tissues. In the testis, Kiss1r mRNA is constitutively expressed from birth through postnatal week 12, showing consistent presence throughout development . This contrasts with the expression pattern of Kiss1 itself, which is not detected in mouse testes until the fourth postnatal week, after which it gradually increases to reach peak levels at 8-12 weeks postpartum .

In ovarian tissue, Kiss1r expression appears to be age-dependent. Immature ovaries show low to negligible levels of Kiss1 mRNA, which significantly increase after gonadotropin priming . The functional role of kisspeptin in regulating follicular development mainly occurs after puberty, consistent with the age-related expression patterns observed in ovarian tissue . Researchers investigating developmental regulation should consider these temporal expression patterns when designing experiments and interpreting results.

What experimental methods are most effective for studying Kiss1r localization in rat tissues?

Based on published research methodologies, the most effective approaches for studying Kiss1r localization in rat tissues include:

  • Immunohistochemistry: This technique has successfully revealed that kisspeptin is expressed in Leydig cells while KISS1R is localized in the seminiferous tubules, specifically on the cell membrane of round spermatids . For reliable results, researchers should:

    • Use specific anti-KISS1R antibodies (immunoglobulin Y antibodies have been validated)

    • Include appropriate positive controls (oviduct tissue has been used successfully)

    • Employ negative controls (sections incubated without primary antibodies)

    • Examine sections at multiple magnifications (1000× magnification is recommended for detailed cellular localization)

  • Quantitative Real-Time PCR: This method effectively quantifies Kiss1r mRNA expression levels in different tissues and developmental stages . For optimal results:

    • Use validated primer sets specific to rat Kiss1r

    • Normalize to appropriate housekeeping genes (cyclophilin or Rpl19 have been used successfully)

    • Express results as fold changes compared to control samples

  • Transgenic Mouse Models: For more advanced studies, transgenic models with Cre recombinase inserted at the translational start site of Kiss1 enable precise characterization of Kiss1 neurons and related receptor distribution .

How does the Kiss1/Kiss1r signaling pathway interact with gonadotropin regulation in rat reproductive physiology?

The interaction between Kiss1/Kiss1r signaling and gonadotropin regulation in rats involves complex bidirectional relationships. Luteinizing hormone (LH) appears to be an upstream regulator of the kisspeptin/KISS1R system in rat testes. Evidence supporting this relationship includes:

  • Expression pattern analysis shows that LH receptor (Lhcgr) expression increases one week earlier than Kiss1 expression during testicular development .

  • Experimental data confirms that Kiss1 mRNA expression increases in LH-treated primary Leydig cells, suggesting direct hormonal regulation .

  • Similarly, Br-cAMP treatment of MA-10 cells increases Kiss1 mRNA expression, indicating that the cAMP signaling pathway mediates this LH-dependent regulation .

In ovarian tissue, kisspeptin is likely a downstream target of LH signals in regulating follicular development. Studies have shown that Kiss1 mRNA significantly increases in rat ovary following injection of human chorionic gonadotropin (hCG) . This relationship plays a critical role in follicle development, as low doses of LH suppress the development of small ovarian follicles while stimulating the growth of large follicles .

For researchers investigating this interaction, experimental designs should consider the temporal relationship between gonadotropin exposure and Kiss1/Kiss1r expression changes. Both in vivo and in vitro approaches may be necessary to fully characterize the regulatory mechanisms.

What are the molecular mechanisms of Kiss1r-mediated intracellular signaling in rat reproductive cells?

Kiss1r activates multiple intracellular signaling pathways in rat reproductive cells, with distinct patterns in different cell types. The primary mechanisms include:

  • MAPK Signaling: Kisspeptin consistently activates the ERK1/2 pathway across multiple cell types. In rat luteal cells, kisspeptin activates ERK1/2 signaling without affecting p38 signaling . This pathway may be particularly important in preventing apoptosis of granulosa cells, as attenuation of MAPK signaling results in granulosa cell apoptosis and follicle atresia .

  • Calcium Signaling: Kisspeptin induces intracellular Ca²⁺ mobilization through a phospholipase C-dependent mechanism, which activates protein kinase C and leads to phosphorylation of ERK1/2 .

  • Arrestin Recruitment: Activated KISS1R can recruit arrestin β-1 and β-2 to the plasma membrane, which further modulates intracellular phosphorylated ERK1/2 levels .

  • FSHR Regulation: Kisspeptin downregulates follicle-stimulating hormone receptor (FSHR) expression in rat follicles, potentially increasing follicle atresia by inhibiting follicular growth and inducing apoptosis of granulosa cells .

Researchers studying these pathways should employ multiple analytical techniques, including phospho-specific antibodies for Western blotting, calcium imaging, and gene expression analysis focusing on downstream targets of these signaling pathways.

How can gene knockout models be effectively utilized to study Kiss1r function in rats?

Gene knockout models have provided significant insights into Kiss1r function, though most published work has been conducted in mice rather than rats. For effective utilization of knockout models in studying Kiss1r function, researchers should consider:

  • Complete vs. Haploinsufficient Models: Both complete knockouts (Kiss1r⁻/⁻ or Kiss1⁻/⁻) and haploinsufficient models (Kiss1r⁺/⁻) provide valuable but distinct information :

    • Complete knockouts display significantly reduced ovarian weight and size with absence of large follicles

    • Haploinsufficient models (Kiss1r⁺/⁻) exhibit premature ovarian failure at 32 weeks with substantial loss of preantral follicles and increased percentage of atretic follicles

  • Age-Dependent Analysis: The phenotypic differences between wildtype and knockout animals change with age. No significant differences in preantral follicle development were observed between wildtype and Kiss1r⁺/⁻ mice before puberty, but progressively decreased numbers of preantral follicles were detected in haploinsufficient mice after puberty .

  • Rescue Experiments: Testing whether the knockout phenotypes can be rescued by hormone treatment provides insight into the mechanism of Kiss1r action. Notably, gonadotropin replacement cannot rescue the follicular reserve depletion in Kiss1r⁺/⁻ mice, suggesting gonadotropin-independent functions .

  • Tissue-Specific Knockouts: For more precise analysis, conditional knockout models using Cre-loxP technology can be generated. A Cre recombinase inserted at the translational start site of Kiss1 has been successfully used for characterizing Kiss1 neurons .

For researchers developing knockout rat models, careful phenotypic characterization at multiple developmental stages is essential, with particular attention to both reproductive and metabolic parameters.

What are the optimal methods for detecting Kiss1r expression in rat tissue samples?

Based on published research protocols, the optimal methods for detecting Kiss1r expression in rat tissue samples include:

  • Quantitative RT-PCR (qPCR):

    • Extract RNA using TRIzol reagent

    • Treat with DNase I (30 min at 37°C)

    • Generate cDNA using random hexamers and SuperScript II Reverse Transcriptase

    • Use SYBR Green PCR master mix for qPCR analysis

    • Normalize mRNA contents to housekeeping genes such as cyclophilin (primers: forward 5′-TGGAGAGCACCAAGACAGACA-3′; reverse 5′-TGCCGGAGTCGACAATGAT-3′)

    • Express results as fold change above control levels

  • Immunohistochemistry:

    • Produce or obtain specific anti-KISS1R antibodies (immunoglobulin Y antibodies have been validated)

    • Process tissue sections according to standard protocols

    • For negative controls, incubate sections without primary antibodies

    • Examine at multiple magnifications, with 1000× recommended for detailed cellular localization

  • In Situ Hybridization:

    • This technique can be used to complement immunohistochemistry for precise localization of Kiss1r mRNA

    • Requires design of specific RNA probes for the rat Kiss1r gene

When reporting results, researchers should include detailed methodological information and appropriate controls to ensure reproducibility.

What experimental design considerations are important when studying the effects of Kiss1r on rat follicular development?

When designing experiments to study the effects of Kiss1r on rat follicular development, researchers should consider:

  • Age-Related Expression Patterns:

    • Kiss1 expression in the ovary is developmentally regulated, with low levels before puberty and significant increases after gonadotropin priming

    • Include multiple age groups in experimental design, particularly comparing pre-pubertal and post-pubertal animals

  • Hormonal Status:

    • Control for or manipulate the hormonal environment, as LH and FSH levels significantly impact Kiss1/Kiss1r expression

    • Consider the estrous cycle stage when collecting samples from adult female rats

  • Quantification Methods:

    • Employ standardized methods for follicle counting and classification

    • Document follicular development across multiple stages (preantral, antral, atretic)

    • Record both ovarian weight/size and detailed histological analysis

  • Mechanistic Studies:

    • Include analysis of MAPK pathway activation, as kisspeptin/KISS1R likely modulates granulosa cell proliferation and apoptosis through this pathway

    • Examine the relationship between Kiss1r expression and FSHR levels, as kisspeptin downregulates FSHR expression in rat follicles

  • In Vivo vs. In Vitro Approaches:

    • Complement in vivo studies with isolated follicle culture or granulosa cell culture systems

    • These controlled systems allow precise manipulation of kisspeptin exposure and measurement of direct effects

What techniques can be used to study Kiss1r signaling pathways in isolated rat reproductive cells?

To effectively study Kiss1r signaling pathways in isolated rat reproductive cells, researchers can employ:

  • Primary Cell Culture Systems:

    • Leydig cell isolation and culture allows for direct testing of LH effects on Kiss1/Kiss1r expression

    • Granulosa cell cultures can be used to examine effects on proliferation and apoptosis

    • MA-10 cells (Leydig tumor cell line) respond to Br-cAMP treatment with increased Kiss1 mRNA expression

  • Signaling Pathway Analysis:

    • Western blotting with phospho-specific antibodies to detect ERK1/2, p38 MAPK, and PI3K/Akt activation

    • Use of pathway-specific inhibitors to determine causal relationships

    • Calcium imaging to measure intracellular Ca²⁺ mobilization

  • Receptor Function Assessment:

    • Radioligand binding assays to measure receptor density and binding affinity

    • cAMP accumulation assays to assess G-protein coupling

    • Arrestin recruitment assays using fluorescent protein-tagged arrestins

  • Gene Expression Regulation:

    • Promoter-reporter constructs to study transcriptional regulation of Kiss1/Kiss1r

    • ChIP assays to identify transcription factors binding to regulatory regions

    • siRNA or shRNA approaches to knockdown pathway components

How can the Kiss1/Kiss1r system be targeted for potential therapeutic applications in reproductive disorders?

The Kiss1/Kiss1r system represents a promising target for therapeutic intervention in reproductive disorders based on its critical role in regulating reproductive function. Potential approaches include:

  • Gonadotropin Secretion Modulation:

    • Kisspeptin administration can stimulate LH and FSH release through actions on hypothalamic GnRH neurons

    • This approach could be useful for treating hypogonadotropic hypogonadism or hypothalamic amenorrhea

  • Follicular Development Enhancement:

    • Based on the finding that Kiss1r haploinsufficient mice exhibit premature ovarian failure , targeted activation of Kiss1r signaling might help maintain follicular reserve

    • This could have applications in treating primary ovarian insufficiency or age-related fertility decline

  • Ovulation Induction:

    • Kisspeptin administration has been shown to trigger ovulation in animal models

    • This represents a potential alternative to traditional ovulation induction methods in assisted reproduction

Research in this area should focus on developing specific Kiss1r agonists or antagonists and testing their effects in appropriate animal models before considering human applications.

What is known about the correlation between Kiss1r expression levels and reproductive outcomes in rat models?

The correlation between Kiss1r expression levels and reproductive outcomes in rat models reveals several key relationships:

  • Follicular Development:

    • Kiss1r haploinsufficient mice with decreased ovarian Kiss1r expression exhibit premature ovarian failure with substantial loss of preantral follicles and increased percentage of atretic follicles

    • The depletion of follicular reserve in these models cannot be rescued by gonadotropin replacement, suggesting direct ovarian effects

  • Testicular Function:

    • Kiss1r is constitutively expressed in rat testes from birth through adulthood

    • Expression patterns of Kiss1 correlate with those of genes essential for testicular development (Lhcgr, Insl3, Cyp19a1)

    • This suggests a role for Kiss1/Kiss1r in supporting normal testicular development and function

  • Developmental Timing:

    • Kiss1 expression in the rat ovary increases following gonadotropin priming

    • The functional role of kisspeptin in regulating follicular development mainly occurs after puberty

    • These findings indicate that the Kiss1/Kiss1r system's reproductive effects are most significant during and after sexual maturation

For researchers studying these correlations, it is important to consider both central (hypothalamic) and peripheral (gonadal) Kiss1r expression when interpreting reproductive phenotypes.

What are the key challenges and considerations in comparing Kiss1r function across different rodent species?

When comparing Kiss1r function across rodent species, researchers should be aware of several challenges and considerations:

  • Species-Specific Expression Patterns:

    • While the general functions of Kiss1/Kiss1r are conserved, the precise expression patterns may differ between rats, mice, and other rodents

    • For example, the timing of developmental expression or the relative importance in different reproductive tissues may vary

  • Methodological Considerations:

    • Antibody specificity may vary across species, requiring validation for each target organism

    • PCR primers must be designed to account for species-specific sequence variations

    • Standardized protocols should be adapted for species-specific differences in tissue processing

  • Functional Differences:

    • The Kiss1r knockout phenotype may have different severities or manifestations across species

    • Response to exogenous kisspeptin administration might vary in magnitude or duration

    • Downstream signaling pathway activation patterns may show species-specific variations

  • Available Research Tools:

    • More genetic models exist for mice than for rats, though this gap is narrowing with CRISPR/Cas9 technology

    • Cell lines derived from different species may show different responses to kisspeptin stimulation

Researchers conducting comparative studies should carefully document these differences and avoid direct extrapolation of findings from one species to another without appropriate validation.

How should researchers interpret changes in Kiss1r expression during different developmental stages in rats?

Proper interpretation of changes in Kiss1r expression during rat development requires consideration of several contextual factors:

  • Tissue-Specific Patterns:

    • In testes, Kiss1r mRNA is constitutively expressed from birth through postnatal week 12

    • In contrast, Kiss1 expression begins around postnatal week 4 and increases through weeks 8-12

    • These distinct patterns suggest different regulatory mechanisms and functional roles

  • Correlation with Hormonal Changes:

    • The expression of Kiss1 in testes correlates with expression of Lhcgr, Insl3, and Cyp19a1

    • This suggests integration with the broader hormonal regulation of reproductive development

    • Researchers should measure relevant hormones (LH, FSH, testosterone, estradiol) alongside Kiss1r expression

  • Relationship to Phenotypic Changes:

    • The timing of Kiss1/Kiss1r expression changes should be interpreted in relation to observable developmental milestones

    • For example, the increase in testicular Kiss1 expression at 4 weeks postpartum coincides with the onset of puberty in male rats

The following table summarizes key developmental expression patterns observed in male rats:

Age (weeks)Kiss1 ExpressionKiss1r ExpressionCorrelated Gene ExpressionDevelopmental Stage
0 (Birth)Not detectedConstitutiveLow Lhcgr, Insl3, Cyp19a1Neonatal
4Begins expressionConstitutiveIncreased Lhcgr, Cyp19a1Pre-pubertal
6IncreasingConstitutiveIncreased Insl3Pubertal transition
8-12Highest levelsConstitutiveHigh Lhcgr, Insl3, Cyp19a1Adult

When interpreting these patterns, researchers should consider both the absolute levels of expression and the rate of change over developmental time.

What statistical approaches are most appropriate for analyzing Kiss1r expression data from rat reproductive tissues?

The appropriate statistical approaches for analyzing Kiss1r expression data depend on the experimental design and specific research questions. Based on published research, the following approaches are recommended:

  • For Developmental Time Course Studies:

    • Repeated measures ANOVA when analyzing the same animals at multiple time points

    • One-way ANOVA with post-hoc tests (such as Tukey's or Bonferroni) for comparing different age groups

    • Express data as fold changes compared to a reference time point (typically adult expression)

  • For Treatment Effect Studies:

    • Paired t-tests for before/after comparisons in the same animals

    • Independent t-tests for comparing treated vs. control groups

    • Two-way ANOVA for examining interactions between treatments and developmental stages

  • For Correlation Analysis:

    • Pearson's correlation coefficient to quantify relationships between Kiss1r expression and other parameters (e.g., hormone levels, expression of related genes)

    • Multiple regression analysis to identify predictors of Kiss1r expression levels

  • Data Transformation Considerations:

    • qPCR data often requires log transformation to meet assumptions of normality

    • Data should be normalized to appropriate housekeeping genes that show stable expression across the conditions being compared

  • Sample Size and Power Analysis:

    • A minimum of 3-5 biological replicates per group is typically used in published studies

    • Conduct power analysis before experiments to determine appropriate sample sizes

    • Report exact p-values rather than simply indicating significance thresholds

When reporting results, include both graphical representations (showing individual data points when possible) and numerical summaries (means ± standard deviation or standard error).

What are the most common challenges in detecting Kiss1r in rat tissues and how can they be overcome?

Researchers often encounter several challenges when detecting Kiss1r in rat tissues. These issues and their solutions include:

  • Low Expression Levels:

    • Challenge: Kiss1r is often expressed at relatively low levels, particularly in certain tissues or developmental stages.

    • Solution: Use highly sensitive detection methods such as nested PCR or digital PCR for mRNA detection, or amplification steps like tyramide signal amplification for immunohistochemistry.

  • Antibody Specificity:

    • Challenge: Many commercially available antibodies show cross-reactivity or lack specificity.

    • Solution: Validate antibodies using appropriate positive and negative controls, including tissues from Kiss1r knockout animals when available. Consider generating custom antibodies, such as the immunoglobulin Y antibody approach described in the literature .

  • Tissue Heterogeneity:

    • Challenge: Kiss1r may be expressed in specific cell types within a heterogeneous tissue.

    • Solution: Use laser capture microdissection to isolate specific cell populations, or employ single-cell RNA sequencing for more detailed expression analysis.

  • Developmental Timing:

    • Challenge: Expression levels change throughout development, potentially leading to false negatives if sampled at the wrong time.

    • Solution: Include multiple developmental time points in study design, with particular attention to pubertal transition periods .

  • Post-Translational Modifications:

    • Challenge: Receptor proteins may undergo modifications affecting antibody recognition.

    • Solution: Use multiple antibodies targeting different epitopes, and consider analyzing receptor mRNA in parallel with protein detection.

  • Receptor Internalization:

    • Challenge: KISS1R may be internalized following ligand binding, reducing cell surface detection.

    • Solution: Consider examining tissues under basal conditions as well as after treatments that might alter receptor trafficking.

How can researchers ensure the specificity and reproducibility of Kiss1r-related experiments in rat models?

To ensure specificity and reproducibility in Kiss1r-related experiments, researchers should implement the following practices:

  • Rigorous Controls:

    • Include appropriate positive and negative controls for all experimental procedures

    • For immunohistochemistry, include tissue sections incubated without primary antibodies as negative controls

    • Use tissues known to express Kiss1r (e.g., hypothalamus) as positive controls

    • When possible, include tissues from Kiss1r knockout animals as gold-standard negative controls

  • Validation of Reagents:

    • Verify antibody specificity through Western blotting and immunoprecipitation

    • Sequence verify all PCR primers and validate their specificity and efficiency

    • Test multiple antibody lots when possible, as lot-to-lot variation can affect results

  • Methodological Transparency:

    • Provide detailed protocols including all critical parameters (antibody dilutions, incubation times, etc.)

    • Report any troubleshooting steps or optimization procedures

    • Document the source and catalog numbers of all key reagents

  • Quantification Methods:

    • Use objective quantification methods with clearly defined parameters

    • For immunohistochemistry, employ digital image analysis when possible

    • For qPCR, follow MIQE guidelines (Minimum Information for Publication of Quantitative Real-Time PCR Experiments)

  • Statistical Rigor:

    • Determine appropriate sample sizes through power analysis

    • Pre-specify primary outcomes and analysis methods

    • Report effect sizes and confidence intervals, not just p-values

  • Independent Replication:

    • Perform key experiments multiple times with independent biological samples

    • Consider having different researchers repeat critical experiments

    • Verify findings using complementary methodological approaches

What emerging technologies could advance our understanding of Kiss1r function in rat reproductive biology?

Several emerging technologies hold promise for advancing our understanding of Kiss1r function in rat reproductive biology:

  • CRISPR/Cas9 Gene Editing:

    • Generation of precise Kiss1r mutations or modifications in rats

    • Creation of reporter systems by knocking in fluorescent proteins at the Kiss1r locus

    • Development of conditional knockout models with tissue-specific or inducible Cre expression

  • Single-Cell Technologies:

    • Single-cell RNA sequencing to identify cell populations expressing Kiss1r

    • Mass cytometry (CyTOF) for simultaneous detection of multiple proteins in individual cells

    • Spatial transcriptomics to map Kiss1r expression in relation to tissue architecture

  • Optogenetics and Chemogenetics:

    • Selective activation or inhibition of Kiss1r-expressing neurons

    • Temporal control of Kiss1r signaling to study dynamic processes

    • Circuit mapping of Kiss1r-expressing cells and their connections

  • Advanced Imaging:

    • Super-resolution microscopy for subcellular localization of Kiss1r

    • In vivo imaging of reporter animals to track Kiss1r expression dynamics

    • Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) to study Kiss1r interactions with other proteins

  • Proteomics Approaches:

    • Proximity labeling methods (BioID, APEX) to identify proteins interacting with Kiss1r

    • Phosphoproteomics to map signaling pathways downstream of Kiss1r activation

    • Interactomics to characterize the dynamic Kiss1r interactome under different conditions

  • Bioinformatics Integration:

    • Multi-omics integration to correlate Kiss1r expression with broader transcriptomic, proteomic, and metabolomic changes

    • Network analysis to position Kiss1r in reproductive regulatory networks

    • Machine learning approaches to identify patterns in complex Kiss1r-related datasets

What aspects of Kiss1r biology in rats remain poorly understood and represent important research opportunities?

Despite significant advances, several aspects of Kiss1r biology in rats remain poorly understood and represent important opportunities for future research:

  • Cell-Type Specific Functions:

    • While Kiss1r is expressed in multiple cell types within reproductive tissues, the specific functions in each cell type are not fully characterized

    • The distinct roles of Kiss1r in different testicular cell populations (Leydig cells, Sertoli cells, germ cells) require further investigation

    • Similarly, the functions in different ovarian cell types (granulosa cells, theca cells, oocytes) need clarification

  • Non-Reproductive Functions:

    • Emerging evidence suggests Kiss1r may have functions beyond reproduction, including roles in metabolism and energy homeostasis

    • The potential involvement in inflammatory processes and immune function represents an unexplored area

    • Cardiovascular effects of kisspeptin signaling require further investigation in rat models

  • Intracellular Signaling Complexity:

    • While ERK1/2 activation is well-established, the complete signaling network downstream of Kiss1r activation remains to be fully mapped

    • The mechanisms determining which signaling pathways are activated in different cell types need clarification

    • The interactions between Kiss1r signaling and other receptor systems (crosstalk) are poorly understood

  • Developmental Programming:

    • How early life experiences or exposures might permanently alter Kiss1r expression or function

    • The potential epigenetic regulation of Kiss1r expression throughout development

    • Transgenerational effects of alterations in Kiss1r signaling

  • Pathophysiological Roles:

    • The involvement of Kiss1r in reproductive pathologies such as polycystic ovary syndrome or endometriosis

    • Potential roles in metabolic disorders and their impact on reproductive function

    • The relationship between Kiss1r function and age-related reproductive decline

  • Translation to Human Biology:

    • While rat models provide valuable insights, the translation to human reproductive biology requires careful validation

    • Species-specific differences in Kiss1r expression, regulation, and function need systematic investigation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.