Recombinant Rat Kit ligand (Kitlg)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

Kitlg regulates multiple pathways through its receptor, c-Kit:

  • Hematopoiesis: Promotes differentiation of erythroid (BFU-E to CFU-E), myeloid, and lymphoid progenitors . Synergizes with G-CSF, GM-CSF, and IL-3 to enhance hematopoietic cell mobilization .

  • Melanogenesis: Critical for melanocyte survival and pigment production .

  • Neurodevelopment: Sustains synaptic connectivity in cerebellar Purkinje cells and molecular layer interneurons .

  • Mast Cell Regulation: Enhances adhesion, migration, and survival .

In Vitro/In Vivo Studies

  • Stem Cell Expansion: Used with G-CSF to mobilize CD34⁺ hematopoietic progenitor cells, achieving a 2–3× increase in clinical trials .

  • Neurodevelopmental Models: Kitlg knockout in mice disrupts cerebellar interneuron synapses, linking it to ataxia and neurodevelopmental disorders .

  • Disease Associations: Mutations correlate with Waardenburg syndrome, hyperpigmentation disorders, and deafness .

Therapeutic Potential

  • Myocardial repair post-infarction via cardiomyocyte proliferation .

  • Alzheimer’s disease: Reduces β-amyloid deposits in combination with G-CSF .

Comparative Product Analysis

VendorHostTagPurityBioactivity (ED₅₀)
Creative BioMartE. coliNone>98%<10 ng/ml (human MO7e cells)
GoldBioE. coliNone>95%<5 ng/ml (murine MC/92 cells)
AssayGenieHEK293His-tag>97%9.95–39.78 ng/ml
AbbexaE. coliHis-tag>95%Not tested

Recent Research Findings

A 2024 study demonstrated that Kitlg-c-Kit signaling is essential for maintaining inhibitory synapses in cerebellar Purkinje cells. Conditional knockout models showed reduced synaptic density and impaired motor coordination, underscoring its role in neurodevelopmental disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your specific needs.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery time information, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
Kitlg; Kitl; Mgf; Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Stem cell factor; SCF; c-Kit ligand
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-273
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
Uniprot No.

Target Background

Function
Kit ligand (KITLG/SCF) acts as a ligand for the receptor-type protein-tyrosine kinase KIT. It plays a critical role in regulating cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and melanogenesis. Binding of KITLG/SCF to its receptor activates various signaling pathways, including the PI3K/AKT, RAS/MAPK, and STAT pathways. It promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leading to AKT1 activation. Moreover, KITLG/SCF and KIT transmit signals through GRB2, activating RAS, RAF1, and MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Notably, KITLG/SCF and KIT stimulate the activation of STAT family members STAT1, STAT3, and STAT5. Furthermore, KITLG/SCF and KIT activate PLCG1, resulting in the production of diacylglycerol and inositol 1,4,5-trisphosphate, crucial cellular signaling molecules. KITLG/SCF exhibits synergistic effects with other cytokines, likely interleukins.
Gene References Into Functions
  1. The SCF/c-KIT system is aberrantly expressed in varicocele (VC) testis, potentially contributing to male infertility caused by VC. PMID: 27707610
  2. Cadmium exposure in newborn rat ovaries has been shown to inhibit follicle development. The SCF/c-kit system may mediate follicle development damage induced by cadmium. Further research is warranted to explore the potential link between this damage and DNA hypomethylation of the SCF/c-kit promoter region. PMID: 28801138
  3. Up-regulation of the NPs/NPR-C and NPs/NPR-A, B/cGMP signaling pathways might be involved in depression-induced loss of gastric ICC by decreasing the production of mSCF. PMID: 26862759
  4. Downregulation of either c-kit or CXCR4 in bone marrow stem cells led to reduced engraftment of circulating bone marrow stem cells and inhibited the reparative effects of transmyocardial revascularization. PMID: 25420576
  5. A 100 nM dose of E2 disrupted the SCF/c-kit system, significantly impacting germ cell survival and male fertility. PMID: 24825426
  6. The SCF/c-kit signaling pathway is crucial for the maintenance of interstitial cells of Cajal phenotype, survival, proliferation, and differentiation. PMID: 24228598
  7. In diabetic colonic dysmotility, the deficiency of endogenous IGF-1 in colonic smooth muscle cells leads to a reduction in SCF expression. PMID: 23745035
  8. Electroacupuncture treatment has been shown to up-regulate the positive cells and mRNA expression of SCF after cerebral ischemia/reperfusion. PMID: 22526758
  9. Overload training inhibits phagocytosis and ROS generation in peritoneal macrophages. Macrophage-derived MGF plays a key role in this process. PMID: 22592456
  10. Activated mature cardiac mast cells are responsible for increasing mature mast cell density after aortocaval fistula by rapidly elevating SCF levels through chymase release. PMID: 22850284
  11. Stem cell factor gene transfer induces c-kit(+) stem/progenitor cell expansion in situ and cardiomyocyte proliferation, presenting a potential therapeutic strategy for reversing adverse remodeling after myocardial infarction. PMID: 22931954
  12. The KL-c-kit interaction is implicated in estrogenic regulation through oocyte-granulosa cell communication. PMID: 22366471
  13. SCF expression along with GM-CSF after hepatectomy contributes to biliary remodeling, potentially impacting post-transplantation outcomes by functionally deregulating key signaling intermediates involved in cell expansion and multipotent differentiation. PMID: 21932404
  14. SCF expression in gastric smooth muscle cells is stimulated by IGF-1 in a dose- and time-dependent manner through IGF-1R, with ERKMAPK signal transduction playing a crucial role. PMID: 21092510
  15. Ghrelin's ability to modulate the expression of the SCF gene has been observed. PMID: 15284210
  16. SCF released from astrocytes directs neural progenitor cell migration under hypoxic conditions. PMID: 17581219
  17. SCF and its receptor may play a role in the remodeling process of serum nephrotoxic nephritis. PMID: 18087173
  18. Stem cell factor/c-kit signaling mediates cardiac stem cell migration through activation of p38 MAPK. PMID: 18087667
  19. 4-vinylcyclohexene diepoxide compromises KIT/KITL signaling, which is essential for follicular survival in primordial and primary follicles. PMID: 18448842
  20. Fetal exposures to DEHP have effects on FLC number, distribution, and steroidogenic capacity. Abnormal expressions of IGF1, KITL, and LIF genes may contribute to the reproductive toxicity of phthalates. PMID: 18469139
  21. Follicle stimulating hormone exerts a protective effect on germ cells after unilateral testicular torsion, as reflected by increased SCF expression. PMID: 18544282
  22. Postsynaptic RapGAP SPAR is regulated by Polo-like kinase 2 and the SCFbeta-TRCP ubiquitin ligase in hippocampal neurons. PMID: 18723513
  23. Upregulation of stem cell factor and c-kit expression occurs after spinal cord injury. Stem cell factor may be a promising therapeutic agent for treating spinal cord injury. PMID: 19182706
  24. mRNA levels are upregulated up to 20-fold in intrahepatic cholangiocarcinoma. PMID: 19255573

Show More

Hide All

Database Links
Protein Families
SCF family
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.

Q&A

What is Recombinant Rat Kit Ligand and what are its structural characteristics?

Recombinant Rat Kit Ligand (Kitlg), also known as Stem Cell Factor (SCF), is a cytokine that binds to CD117 (c-Kit). The protein exists in two forms: cell surface-bound SCF and soluble (free) SCF, with the soluble form produced by metalloprotease cleavage of the membrane-bound form .

The recombinant version typically consists of a single, non-glycosylated polypeptide chain. When produced in E. coli, it contains 165 amino acids with a molecular mass of approximately 18,409 Dalton . The sequence of the first five N-terminal amino acids is Met-Gln-Glu-Ile-Cys . In HEK293 cell-expressed versions, the sequence typically spans Gln26-Ala189 of rat c-Kit ligand (Accession #NP_068615.1) .

The protein may include fusion tags, such as a C-terminal 6×His tag, to facilitate purification and detection, resulting in slightly different molecular weights depending on the expression system and construct design .

How do Recombinant Rat Kit Ligand expression systems differ, and how might this impact experimental outcomes?

Recombinant Rat Kit Ligand can be produced in different expression systems, primarily E. coli and mammalian cells (e.g., HEK293), which significantly affects protein characteristics and experimental applications:

E. coli expression system:

  • Produces non-glycosylated protein

  • Typically yields higher protein amounts

  • May have different folding patterns

  • Molecular mass approximately 18.4 kDa

  • Suitable for applications where glycosylation is not critical

  • Often appears as a sterile filtered white lyophilized powder

HEK293 mammalian expression system:

  • Produces protein with post-translational modifications similar to native protein

  • More physiologically relevant glycosylation patterns

  • Apparent molecular mass approximately 19.3 kDa

  • Potentially higher bioactivity in certain assays

  • May better represent in vivo functionality

The choice of expression system should be based on the specific research objectives. For studies investigating basic binding or preliminary screening, E. coli-expressed protein may be sufficient. For research examining complex signaling pathways or mimicking physiological conditions, mammalian-expressed protein would be more appropriate due to proper folding and post-translational modifications.

What are the biological activity parameters for Recombinant Rat Kit Ligand and how are they measured?

Biological activity of Recombinant Rat Kit Ligand is primarily assessed through cell proliferation assays using responsive cell lines. Key parameters include:

Activity measurement:

  • ED50 (effective dose for 50% maximal response) is determined by dose-dependent stimulation of cell proliferation

  • For E. coli-expressed protein: ED50 is typically < 10 ng/ml, corresponding to a specific activity of > 1 × 10^5 units/mg

  • For HEK293-expressed protein: ED50 ranges from 9.95-39.78 ng/ml, corresponding to a specific activity of 2.51×10^4 to 1.01×10^5 units/mg

Cell lines commonly used:

  • Human MO7e cells (for E. coli-expressed protein)

  • MC/9-2 mouse mast cells (for HEK293-expressed protein)

The activity assay involves treating responsive cells with serial dilutions of the recombinant protein, measuring proliferation (often via MTT/XTT assay or [3H]-thymidine incorporation), and calculating the concentration required for half-maximal stimulation. Variations in activity between different preparations should be considered when designing experiments, particularly when comparing results across studies or changing reagent sources.

What are the optimal reconstitution and storage conditions for maintaining Recombinant Rat Kit Ligand activity?

Proper handling of Recombinant Rat Kit Ligand is crucial for maintaining its activity. Based on manufacturer recommendations, the following guidelines should be followed:

Reconstitution:

  • For lyophilized E. coli-expressed Kitlg: Reconstitute in sterile 18MΩ-cm H2O at a concentration not less than 100 μg/ml

  • For HEK293-expressed protein: Reconstitute in PBS (pH 7.4)

  • Gentle mixing is recommended; avoid vigorous vortexing that may cause protein denaturation

  • Filter sterilization (0.2 μm) may be performed if required for cell culture applications

Storage conditions:

  • Lyophilized protein: Store at -20°C to -80°C for up to 12 months

  • Reconstituted protein:

    • Short-term (2-7 days): 4°C

    • Medium-term (up to 3 months): -20°C in aliquots

    • Long-term: Below -18°C with a carrier protein (0.1% HSA or BSA)

  • Avoid repeated freeze-thaw cycles as they significantly decrease protein activity

For optimal results, prepare small aliquots immediately after reconstitution to minimize freeze-thaw cycles. When using in experiments, thaw aliquots on ice and keep the working solution cold throughout handling. Activity testing before critical experiments is recommended, especially if the protein has been stored for extended periods.

How should Recombinant Rat Kit Ligand be incorporated into hematopoietic stem cell culture protocols?

Incorporating Recombinant Rat Kit Ligand in hematopoietic stem cell culture requires careful consideration of concentration, timing, and combination with other cytokines:

Standard protocol guidelines:

  • Prepare a stock solution of Recombinant Rat Kit Ligand at 10-100 μg/ml in appropriate buffer

  • For hematopoietic stem cell cultures, typical working concentrations range from 10-100 ng/ml

  • Combine with other cytokines for synergistic effects:

    • For myeloid lineage development: Use with GM-CSF and IL-3

    • For erythroid lineage: Combine with erythropoietin

    • For mobilization of peripheral blood progenitor cells: Use with G-CSF

Optimization considerations:

  • Titrate Kitlg concentration for your specific cell type and research objective

  • For long-term cultures, supplement fresh cytokines every 2-3 days

  • Consider the activation state of your target cells; some may require pre-stimulation with other factors

  • For differentiation protocols, the timing of Kitlg addition is critical and may need to be sequentially regulated

Kitlg plays a crucial role in changing BFU-E (burst-forming unit-erythroid) cells, which are early erythrocyte precursors, into CFU-E (colony-forming unit-erythroid) . This specific function should be considered when designing protocols for erythroid differentiation studies.

What experimental readouts are most informative when studying the effects of Recombinant Rat Kit Ligand on neural development?

When investigating Recombinant Rat Kit Ligand's effects on neural development, several readouts provide valuable insights into its biological functions:

Cellular readouts:

  • Electrophysiological recordings of postsynaptic currents in neurons (e.g., Purkinje cells)

  • Immunohistochemistry to assess changes in neuronal morphology and connectivity

  • Live-cell calcium imaging to evaluate alterations in neural activity

  • Measurement of neurite outgrowth and branching patterns

Molecular readouts:

  • Analysis of Kit receptor tyrosine kinase phosphorylation status

  • Evaluation of downstream signaling pathway activation:

    • STAT1, STAT3, and STAT5 activation

    • PI3K/AKT pathway through phosphorylation of PIK3R1

    • RAS/RAF1/MAPK pathways (ERK1/2)

  • RT-qPCR assessment of neurogenic gene expression changes

Functional readouts:

  • Behavioral tests in animal models with genetic manipulation of Kit or Kitlg

  • Synapse formation and maintenance assessment through electrophysiology and imaging

  • Long-term potentiation (LTP) and depression (LTD) in cerebellar circuits

Recent research has shown that Kit is enriched in molecular layer interneurons (MLIs) of the cerebellar cortex, while Kit Ligand is selectively expressed by Purkinje cells (PCs) . This mutually exclusive expression pattern is functionally significant, as genetic manipulation of PC Kit Ligand and MLI Kit alters inhibition of PCs in vivo . This suggests measuring inhibitory postsynaptic currents in PCs is a particularly relevant readout when studying Kitlg effects on cerebellar development and function.

How does Recombinant Rat Kit Ligand regulate different signaling pathways in various cell types?

Recombinant Rat Kit Ligand activates multiple signaling pathways upon binding to the Kit receptor, with pathway specificity often determined by cell type and context:

Key signaling pathways activated:

  • PI3K/AKT pathway:

    • Kitlg binding promotes phosphorylation of PIK3R1 (regulatory subunit of phosphatidylinositol 3-kinase)

    • Leads to subsequent activation of the kinase AKT1

    • Critical for cell survival and proliferation signals

  • RAS/RAF/MAPK pathway:

    • Kitlg and Kit transmit signals via GRB2 adapter protein

    • Activates RAS, followed by RAF1

    • Ultimately leads to activation of MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1

    • Primarily regulates cell proliferation and differentiation

  • STAT signaling:

    • Kitlg binding to Kit promotes activation of STAT family members

    • Specifically activates STAT1, STAT3, and STAT5

    • Regulates gene expression related to cell growth and cytokine responses

  • Src family kinase pathway:

    • Less characterized but important for specific cell responses

    • Can activate PLCγ leading to calcium signaling

The relative importance and activation kinetics of these pathways vary by cell type. For example, in hematopoietic stem cells, PI3K/AKT signaling may be predominant for survival, while in melanocytes, MAPK signaling may be more critical for differentiation. In neural tissues, the Kit/Kitlg signaling appears particularly important for synaptic function, as demonstrated by the role in cerebellar Purkinje cell inhibition .

What is the role of Recombinant Rat Kit Ligand in synaptic maintenance and neural connectivity?

Recent research has revealed a previously underappreciated role for Kit Ligand and Kit receptor in neural function, particularly in synaptic maintenance and connectivity:

Neural expression pattern:

  • Kit is enriched in molecular layer interneurons (MLIs) of the cerebellar cortex (stellate and basket cells)

  • Kit Ligand is selectively expressed by Purkinje cells (PCs), which are targets of MLI inhibition

  • This mutually exclusive expression pattern suggests a trans-synaptic signaling mechanism

Functional significance:

  • In vivo genetic manipulation studies show that PC Kit Ligand and MLI Kit are required for inhibition of PCs

  • This system functions throughout development and into adulthood

  • The Kit Ligand/Kit receptor dyad is capable of driving changes in inhibitory synaptic transmission

Mechanistic insights:

  • Kit Ligand-Kit signaling likely maintains functional inhibitory synapses between MLIs and PCs

  • The trans-synaptic interaction may regulate synapse formation, stability, or neurotransmitter release

  • This mechanism may explain the association of Kit mutations with neurodevelopmental disorders

This research highlights the importance of Kit signaling beyond its established roles in development and suggests that Recombinant Rat Kit Ligand could be a valuable tool for investigating synaptic plasticity, inhibitory circuit function, and potentially therapeutic approaches for neurodevelopmental disorders associated with Kit mutations.

How does Recombinant Rat Kit Ligand influence hematopoietic differentiation pathways?

Recombinant Rat Kit Ligand is a critical regulator of hematopoietic differentiation, influencing multiple cell lineages through distinct mechanisms:

Erythroid lineage effects:

  • Converts BFU-E (burst-forming unit-erythroid) cells, the earliest erythrocyte precursors, into CFU-E (colony-forming unit-erythroid)

  • This transition is essential for proper erythrocyte development

  • Acts in concert with erythropoietin to promote red blood cell maturation

Myeloid lineage regulation:

  • Synergizes with GM-CSF and IL-3 to stimulate proliferation and differentiation of myeloid cells

  • Supports development of granulocytes, macrophages, and related cell types

  • Critical for maintaining adequate populations of innate immune cells

Lymphoid effects:

  • Influences early lymphoid progenitor survival and proliferation

  • May impact B and T cell development at specific stages

Stem cell maintenance:

  • Supports hematopoietic stem cell survival and self-renewal

  • Prevents premature differentiation through maintenance of stemness factors

  • Establishes the proper microenvironment for stem cell niches

Clinical applications:

  • In clinical studies, combination of SCF and G-CSF resulted in a two- to threefold increase in CD34+ cells compared with G-CSF alone

  • This synergistic effect enhances mobilization of peripheral blood progenitor cells

  • Potential application in stem cell transplantation protocols

These multiple effects on hematopoiesis make Recombinant Rat Kit Ligand an essential tool for studying blood cell development and a potential therapeutic agent for conditions requiring hematopoietic support or stem cell mobilization.

How do the soluble and membrane-bound forms of Kit Ligand differ in their biological functions?

Kit Ligand exists in two distinct forms—membrane-bound and soluble—with important functional differences that should be considered in research applications:

Structural distinctions:

  • Membrane-bound Kit Ligand: Full-length transmembrane protein expressed on cell surfaces

  • Soluble Kit Ligand: Produced by metalloprotease cleavage of the membrane-bound form

  • Recombinant proteins typically mimic the soluble form's active domain

Functional differences:

ParameterMembrane-bound Kit LigandSoluble Kit Ligand
Signaling durationProlonged/sustainedTransient/acute
Receptor internalizationSlower, potentially reducedRapid
Local concentrationRestricted to cell-cell contactDiffusible, concentration gradient
Secondary signalingMay engage additional co-receptorsPrimarily Kit-specific
Biological contextDevelopment, stem cell nichesInflammation, emergency hematopoiesis

Research implications:

  • For studies requiring persistent Kit signaling (e.g., long-term stem cell maintenance), co-culture with cells expressing membrane-bound Kit Ligand may be more effective than recombinant soluble protein

  • For acute stimulation experiments, recombinant soluble Kit Ligand provides more precise temporal control

  • In some experimental systems, immobilizing recombinant Kit Ligand on surfaces or beads may better mimic the membrane-bound form's effects

When designing experiments, researchers should consider whether the biological process under investigation would naturally involve membrane-bound, soluble, or both forms of Kit Ligand, and select appropriate experimental approaches accordingly.

What are the most effective approaches for studying Kit Ligand-Kit receptor interactions in complex neural circuits?

Investigating Kit Ligand-Kit receptor interactions in neural circuits presents unique challenges due to the complexity of the nervous system. Several advanced approaches can be employed:

Genetic manipulation strategies:

  • Conditional and inducible knockout/knockin models using Cre-loxP systems

  • Cell-type specific manipulation (e.g., MLI-specific Kit deletion or PC-specific Kit Ligand deletion)

  • Temporal control using tamoxifen-inducible systems to distinguish developmental vs. maintenance roles

  • CRISPR/Cas9-mediated genome editing for precise mutation introduction

Functional assessment techniques:

  • Electrophysiological recordings to measure synaptic strength and plasticity

  • Example: Measure postsynaptic currents in Purkinje cells from control animals versus those with Kit knockout

  • Multi-electrode arrays for circuit-level activity monitoring

  • Optogenetic manipulation combined with Kit pathway modulation

Molecular interaction analysis:

  • FRET/BRET techniques to visualize Kit-Kit Ligand binding in living neurons

  • Proximity ligation assays for detecting endogenous protein interactions

  • Super-resolution microscopy to visualize synapse-specific signaling events

  • Mass spectrometry to identify Kit signaling partners in neural contexts

Behavioral correlates:

  • Cerebellum-dependent motor learning tasks in animals with manipulated Kit signaling

  • Cognitive tests relevant to suspected Kit-related neurodevelopmental disorders

  • Longitudinal assessment to capture developmental trajectories

Recent research has employed genetic manipulation spanning embryonic development through adulthood to demonstrate that PC Kit Ligand and MLI Kit are required for inhibition of PCs . This approach, combining cell-type specific genetic tools with functional electrophysiological readouts, represents a powerful paradigm for investigating Kit signaling in neural circuits.

How can researchers differentiate between direct effects of Recombinant Rat Kit Ligand and secondary effects mediated through other signaling molecules?

Distinguishing direct Kit Ligand effects from secondary signaling cascades requires sophisticated experimental designs:

Temporal analysis approaches:

  • Acute stimulation time courses (seconds to minutes) to identify immediate Kit receptor activation events

  • Pathway inhibitor pretreatment to block specific downstream effectors

  • Pulse-chase experiments to track primary signaling waves versus secondary responses

Molecular pathway dissection:

  • Pharmacological inhibitors targeting specific downstream pathways:

    • PI3K inhibitors (e.g., LY294002) to block AKT activation

    • MEK inhibitors (e.g., U0126) to block MAPK/ERK pathways

    • JAK inhibitors to prevent STAT activation

  • Genetic approaches using dominant-negative pathway components

  • Phosphoproteomic analysis to identify direct Kit-dependent phosphorylation events

Receptor engineering strategies:

  • Structure-function analysis using Kit receptor mutants with altered signaling capabilities

  • Chimeric receptors containing Kit extracellular domain with alternative intracellular signaling domains

  • FRET-based biosensors to visualize Kit activation in real-time

Control experiments:

  • Comparison with Kit receptor antagonists to confirm specificity

  • Parallel analysis in Kit-deficient cells reconstituted with wild-type or mutant receptors

  • Use of Kit Ligand blocking antibodies to confirm observed effects are ligand-dependent

Experimental validation matrix:

ObservationDirect Kit effect if:Secondary effect if:
TimingRapid (seconds-minutes)Delayed (hours)
Persists with protein synthesis inhibitionYesNo
Occurs in isolated membrane preparationsYesNo
Requires specific Kit phosphorylation sitesYesVaries
Blocked by immediate downstream inhibitorsYesMay still occur

By systematically applying these approaches, researchers can build a comprehensive understanding of which cellular responses represent direct Kit Ligand signaling versus secondary effects mediated through other pathways or cellular adaptations.

What are common causes of reduced Recombinant Rat Kit Ligand activity and how can they be addressed?

Decreased activity of Recombinant Rat Kit Ligand can significantly impact experimental outcomes. Here are common issues and solutions:

Storage and handling issues:

  • Excessive freeze-thaw cycles: Aliquot reconstituted protein and limit to ≤3 freeze-thaw cycles

  • Improper temperature: Store lyophilized protein at -20°C to -80°C and reconstituted protein as recommended

  • Protein adsorption to surfaces: Add carrier protein (0.1% HSA or BSA) for long-term storage

  • Improper reconstitution: Use recommended buffers and concentration (typically sterile 18MΩ-cm H2O at ≥100 μg/ml for E. coli-expressed protein)

Experimental design factors:

  • Inappropriate assay cells: Verify cells express functional Kit receptor

  • Media components interference: Some serum components or additives may inhibit activity

  • Incorrect concentration range: Establish a dose-response curve (ED50 typically 9.95-39.78 ng/ml for HEK293-expressed protein)

  • Timing issues: Kit receptor may be downregulated after prolonged exposure

Quality control measures:

  • Activity testing: Compare to a reference standard using cell proliferation assays with appropriate cells (e.g., MC/9-2 mouse mast cells or human MO7e cells)

  • Protein integrity assessment: Analyze by SDS-PAGE to confirm expected molecular weight (18.4-19.3 kDa depending on expression system)

  • Endotoxin testing: Ensure levels <1.0 EU per μg as endotoxin can interfere with cellular responses

Optimization strategies:

  • Supplement with protease inhibitors during handling

  • Filter sterilize rather than heat sterilize

  • Optimize storage buffer pH and salt concentration

  • For critical experiments, perform side-by-side testing of new and proven lots

Regular quality control testing using standardized bioassays is essential, particularly before critical experiments or when using protein that has been stored for extended periods.

How can inconsistent results between different batches of Recombinant Rat Kit Ligand be reconciled and normalized?

Batch-to-batch variability in Recombinant Rat Kit Ligand is a common challenge that requires systematic normalization approaches:

Sources of batch variation:

  • Expression system differences (E. coli vs. HEK293 cells)

  • Purification method variations

  • Protein folding efficiency

  • Post-translational modification differences

  • Storage time and conditions

Quantitative normalization methods:

  • Bioactivity normalization:

    • Establish a standard curve using a reference batch in a proliferation assay

    • Calculate relative potency of new batches (EC50 ratio)

    • Adjust working concentrations based on relative potency rather than protein mass

  • Receptor binding normalization:

    • Perform competitive binding assays with labeled reference Kit Ligand

    • Determine relative binding affinity (IC50)

    • Normalize concentrations based on binding equivalents

  • Pathway activation normalization:

    • Measure phosphorylation of key downstream effectors (e.g., ERK1/2, AKT)

    • Use Western blot or ELISA to quantify activation levels

    • Adjust concentrations to achieve equivalent pathway activation

Implementation strategies:

StageActionBenefit
ProcurementRequest Certificate of Analysis with specific activityEnables theoretical normalization
Pre-experimentPerform in-house bioactivity testingAllows practical normalization
Experimental designInclude internal reference controlsEnables inter-experiment calibration
Data analysisNormalize to baseline and positive controlsReduces batch effect in results
Long-termMaintain reference standard aliquotsEnsures consistent normalization

When publishing research using Recombinant Rat Kit Ligand, thoroughly document the source, batch information, normalization methods, and actual bioactivity used, rather than simply reporting mass concentration. This practice enhances experimental reproducibility across different research groups.

What are the optimal experimental controls for validating Kit Ligand-mediated effects in complex biological systems?

Rigorous control strategies are essential when studying Kit Ligand effects, particularly in complex systems like neural tissues or heterogeneous cell populations:

Negative controls:

  • Kit receptor blocking:

    • Anti-Kit neutralizing antibodies

    • Specific Kit tyrosine kinase inhibitors (e.g., imatinib)

    • Competitive antagonists of Kit-Kit Ligand binding

  • Genetic controls:

    • Kit receptor knockout/knockdown in target cells

    • Comparison with Kit receptor mutants lacking specific signaling domains

    • Cell-type specific Kit deletion using Cre-loxP systems

  • Inactive Kit Ligand controls:

    • Heat-denatured Recombinant Rat Kit Ligand

    • Recombinant Kit Ligand with mutated receptor binding domain

    • Irrelevant recombinant proteins of similar size/structure

Pathway validation controls:

  • Downstream signaling verification:

    • Parallel treatment with established pathway activators

    • Pathway inhibitor panels to identify specific mechanisms

    • Phospho-protein analysis of known Kit targets

  • Readout specificity controls:

    • Alternative stimuli that produce similar cellular responses

    • Time-course analysis to distinguish direct vs. indirect effects

    • Dose-response relationships to confirm biological relevance

Experimental design controls:

  • System-specific considerations:

    • For neural experiments: comparison between Kit-expressing and non-expressing neuronal populations

    • For hematopoietic studies: lineage-specific markers to track specific cell populations

    • For developmental studies: temporal controls using inducible systems

  • Combined approach examples:

    • Electrophysiological recordings from Purkinje cells in animals with Kit knockout compared to controls

    • Complementary gain- and loss-of-function approaches

    • Rescue experiments reintroducing Kit or downstream effectors

A particularly robust approach, as demonstrated in recent research, is to employ complementary genetic manipulations spanning development through adulthood, showing both requirement for and ability to drive the biological process of interest (as shown with PC Kit Ligand and MLI Kit in cerebellar inhibition) .

What are the emerging applications of Recombinant Rat Kit Ligand in neurological disorder research?

Recent discoveries regarding Kit Ligand's role in neural function have opened promising avenues for neurological disorder research:

Neurodevelopmental disorders:

  • The association of Kit mutations with rare neurological dysfunction (pLI= 0.98 and LOEUF of 0.17) suggests Kit Ligand as a potential therapeutic target

  • Investigation of Kit Ligand's role in synapse formation and maintenance could provide insights into disorders characterized by synaptic dysfunction

  • The mutual exclusivity of Kit and Kit Ligand expression in specific neuron populations may represent a broader principle of neural organization relevant to developmental disorders

Cerebellar dysfunction:

  • Given Kit Ligand's role in cerebellar inhibitory circuits , it may be relevant to cerebellar ataxias

  • Potential involvement in conditions with altered inhibitory/excitatory balance

  • May play a role in cerebellum-associated learning disorders

Neurorestorative approaches:

  • Kit Ligand's ability to drive changes in inhibitory synaptic transmission suggests potential for modulating neural circuit function

  • Possible applications in circuit-specific neuromodulation strategies

  • May inform approaches to restore proper inhibitory tone in hyperexcitability disorders

Translational research directions:

  • Development of small molecule modulators of Kit-Kit Ligand signaling with CNS penetrance

  • Creation of conditional genetic models specific to neuronal Kit signaling

  • Investigation of Kit polymorphisms in human neurological disorder cohorts

The discovery that the Kit Ligand/Kit receptor dyad sustains mammalian central synapse function represents a paradigm shift in understanding Kit signaling beyond its established developmental roles. This opens new possibilities for therapeutic approaches targeting specific neural circuits through Kit pathway modulation.

How might emerging techniques in protein engineering enhance the utility of Recombinant Rat Kit Ligand for research applications?

Protein engineering technologies are creating exciting opportunities to develop enhanced versions of Recombinant Rat Kit Ligand with improved properties for research applications:

Stability and half-life engineering:

  • Fusion to stabilizing domains (e.g., Fc fragments) to extend half-life

  • PEGylation strategies to reduce proteolytic degradation

  • Disulfide engineering to enhance thermal stability

  • Deimmunized variants for in vivo applications with reduced immunogenicity

Functional modifications:

  • Super-agonist variants with enhanced receptor binding affinity

  • Engineered variants with altered signaling bias (e.g., preferential activation of specific downstream pathways)

  • Photoactivatable or chemically inducible Kit Ligand for precise temporal control

  • Split-protein complementation systems for spatial control of activation

Targeting and visualization:

  • Site-specific conjugation with fluorophores for direct visualization

  • Membrane-tethered variants to mimic cell surface presentation

  • Cell type-targeting through fusion with antibody fragments or peptides

  • Scaffold-binding domains for localized delivery in tissue engineering

Emerging applications:

Engineering ApproachPotential ApplicationResearch Advantage
Bifunctional Kit Ligand-cytokine fusionsHematopoietic researchSimultaneous activation of complementary pathways
Optogenetic Kit Ligand variantsNeural circuit researchMillisecond-scale temporal control
Conditionally active Kit LigandDevelopmental biologyStage-specific pathway activation
Single-chain Kit Ligand dimersSignaling mechanism studiesDefined stoichiometry and orientation

These engineered variants would enable more precise manipulation of Kit signaling in complex experimental systems, potentially revealing new aspects of Kit biology that are currently obscured by the limitations of native protein. The development of such tools would be particularly valuable for neural research where spatial and temporal precision in signaling pathway activation is crucial.

What are the key considerations for researchers designing experiments with Recombinant Rat Kit Ligand across different biological systems?

When designing experiments using Recombinant Rat Kit Ligand, researchers should consider several critical factors that span technical, biological, and analytical domains:

Technical considerations:

  • Select the appropriate expression system (E. coli vs. HEK293) based on research questions

  • Follow optimal reconstitution protocols and storage conditions to maintain activity

  • Implement thorough quality control through activity testing and protein integrity assessment

  • Establish appropriate concentration ranges based on target cells (ED50 typically <10-40 ng/ml)

Biological system considerations:

  • Verify Kit receptor expression in target cells or tissues

  • Account for endogenous Kit Ligand that may affect baseline responses

  • Consider the distinct roles of membrane-bound versus soluble Kit Ligand forms

  • Recognize potential cross-talk with other signaling pathways

Experimental design elements:

  • Include comprehensive controls (pathway inhibitors, receptor blocking, etc.)

  • Design time-course experiments to distinguish direct from indirect effects

  • Combine multiple readouts to capture the full spectrum of biological responses

  • Consider potential species differences when translating between models

Analytical approaches:

  • Employ quantitative methods to measure pathway activation

  • Use appropriate statistical analyses for complex biological responses

  • Document all experimental parameters thoroughly for reproducibility

  • Consider how Kit Ligand effects may vary across different cellular contexts

The complexity of Kit signaling—spanning neural, hematopoietic, and developmental systems—demands careful experimental design that accounts for the specific biology of the system under investigation while maintaining technical rigor in handling this sensitive cytokine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.