Recombinant Rat L-selectin (Sell)

Shipped with Ice Packs
In Stock

Description

Leukocyte Adhesion Assays

Recombinant Rat L-selectin demonstrates dose-dependent adhesion in vitro:

  • ED₅₀: 0.4–2 μg/mL in lymphocyte adhesion assays

  • Ligands: Binds CD34, PSGL-1, and podocalyxin-like protein 2 (PODXL2) with sLeˣ-dependent specificity .

ELISA and Detection Kits

Commercial kits (e.g., Assay Genie RTEB0065) quantify L-selectin with:

ParameterValue
Detection range78–5,000 pg/mL
Sensitivity40.6 pg/mL
Intra-assay CV7.4%
Inter-assay CV10.4%
Sample typesSerum, plasma, homogenates

Role in T Cell Homing

  • L-selectin shedding is not required for T cell homing to peripheral lymph nodes (PLNs) .

  • Transgenic mice expressing noncleavable L-selectin (LΔP) showed normal lymphocyte recruitment but reduced soluble L-selectin levels (<5% of wild-type) .

Inflammatory Regulation

  • Retained L-selectin on activated T cells prevents reentry into PLNs, suggesting a regulatory role in immune responses .

  • Soluble L-selectin levels correlate with autoimmune and rheumatic diseases, making it a biomarker candidate .

Signaling Mechanisms

  • The cytoplasmic tail interacts with ezrin-radixin-moesin (ERM) proteins to regulate cytoskeletal dynamics during TEM .

  • Tyrosine sulfation of PSGL-1 enhances L-selectin binding affinity .

Clinical and Therapeutic Relevance

  • Inhibition studies: Targeting L-selectin reduces chronic inflammation in rheumatoid arthritis models .

  • Cancer research: Overexpression on Treg cells correlates with suppressed tumor growth .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for your order.
Synonyms
Sell; Lnhr; Ly-22; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; Lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; CD antigen CD62L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-372
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
WTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSQERMDDPY
Uniprot No.

Target Background

Function
L-selectin, a calcium-dependent lectin, mediates cell adhesion by binding to glycoproteins on neighboring cells. It facilitates lymphocyte adherence to endothelial cells of high endothelial venules in peripheral lymph nodes. This interaction promotes the initial tethering and rolling of leukocytes within the endothelium.
Database Links
Protein Families
Selectin/LECAM family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in peripheral blood mononuclear cells (PBMC), spleen and thymus.

Q&A

What are the main functional domains of L-selectin and their roles in cell adhesion?

L-selectin contains several distinct functional domains that contribute to its adhesive properties:

  • N-terminal C-type lectin domain: Essential for calcium-dependent recognition of specific carbohydrate structures, particularly sialylated and fucosylated oligosaccharides containing the sialyl Lewis x (sLex) motif

  • Epidermal growth factor (EGF)-like domain: Works with the lectin domain to stabilize binding interactions

  • Short consensus repeat (SCR) domains: Provide structural support and extend the lectin domain away from the cell surface

  • Transmembrane domain: Anchors L-selectin to the cell membrane

  • Cytoplasmic domain: Mediates signaling and interactions with the cytoskeleton

Functional studies have demonstrated that the lectin domain's interaction with carbohydrate structures is strictly calcium-dependent, as calcium chelation completely inhibits binding . Mutation studies have identified specific residues within these domains that are critical for optimal binding to different ligands, providing targets for designing inhibitors of L-selectin function.

How is L-selectin expression regulated in different leukocyte populations?

L-selectin expression varies significantly across leukocyte subsets and undergoes dynamic regulation during immune responses. L-selectin is constitutively expressed on most lymphocytes (except a substantial population of memory T cells), monocytes, and polymorphonuclear cells . In early progenitor cells, L-selectin facilitates trafficking from bone marrow toward peripheral lymphoid organs .

Regulation occurs at both transcriptional and post-translational levels. Post-translationally, L-selectin undergoes ectodomain shedding mediated by ADAM17, a metalloproteinase that cleaves the extracellular portion from the cell surface . This explains why mouse neutrophils lacking ADAM17 express higher than average surface levels of L-selectin . Various stimuli can trigger shedding, including antibody-mediated cross-linking and cellular activation.

The density of L-selectin expression varies between T-cell subsets and correlates with functional capabilities . The lifespan of central memory T-cells inversely correlates with L-selectin expression levels . Researchers should consider these variations when isolating specific leukocyte populations and interpreting results from mixed cell populations.

What are the most effective methods for producing recombinant rat L-selectin?

Production of functional recombinant rat L-selectin requires careful consideration of expression systems and purification strategies. A proven approach involves constructing a cDNA for rat L-selectin-IgG chimera (rLEC-IgG), expressing it in mammalian cells, and purifying the secreted recombinant protein . Specifically:

  • Construct design: The extracellular domain of rat L-selectin (Trp39-Asn332) fused to the Fc portion of human IgG1 (Pro100-Lys330)

  • Expression system: Mammalian expression systems (CHO or HEK293 cells) are preferred over bacterial systems as they provide proper glycosylation essential for function

  • Purification: Affinity chromatography using protein A/G columns for Fc-tagged constructs

  • Reconstitution: Optimal activity is achieved by reconstituting lyophilized protein at 100 μg/mL in sterile PBS

Quality control should include verification of molecular weight by SDS-PAGE, binding activity to known ligands, and confirmation of calcium dependence. The resulting chimeric protein maintains the binding specificity of native L-selectin while providing enhanced stability and detection through the Fc tag.

How can L-selectin-mediated adhesion be measured in vitro?

L-selectin-mediated adhesion can be quantitatively assessed through several complementary approaches:

  • Static adhesion assays: Coat plates with recombinant rat L-selectin and measure cellular adhesion after incubation. Data shows that when cells are added to plates coated with recombinant rat L-selectin Fc chimera, adhesion is induced dose-dependently after 1-hour incubation at 37°C, with an ED₅₀ of 0.4-2 μg/mL .

  • Frozen section binding assays: Lymphocyte binding to high endothelial venules (HEV) on lymph node sections can be specifically blocked using either recombinant L-selectin-IgG or anti-L-selectin monoclonal antibodies .

  • Flow chamber assays: For physiologically relevant conditions, leukocytes can be perfused over immobilized ligands or endothelial monolayers under controlled shear stress, allowing measurement of:

    • Tethering frequency

    • Rolling velocity

    • Transition to firm adhesion

  • Molecular interaction studies: Solid-phase binding assays using purified L-selectin and potential ligands can determine binding affinities and calcium dependence.

The specific contribution of L-selectin can be determined using blocking antibodies or comparing wild-type cells with L-selectin knockout or knockdown cells.

How can researchers differentiate between membrane-bound and soluble L-selectin?

Distinguishing between membrane-bound and soluble L-selectin is essential for comprehensive analysis of L-selectin biology. Soluble L-selectin arises from two sources: proteolytic cleavage (shedding) of membrane-bound L-selectin and alternative splicing that produces a variant lacking the transmembrane domain .

Methods for detection:

  • Membrane-bound L-selectin:

    • Flow cytometry with antibodies against the extracellular domain

    • Immunofluorescence microscopy of intact cells

    • Cell surface biotinylation followed by immunoprecipitation

  • Soluble L-selectin:

    • Enzyme-linked immunosorbent assays (ELISAs) like the Rat L-Selectin (SELL/CD62L) ELISA Kit for quantitation in serum, plasma, or cell culture medium

    • Western blotting of concentrated supernatants or biological fluids

    • Immunoprecipitation from cell-free samples

When analyzing soluble L-selectin as a biomarker for leukocyte activation, researchers should note that decreased levels might not always indicate reduced activation. Paradoxically, in conditions like sepsis, soluble L-selectin levels can drop due to adsorption to upregulated vascular ligands . Therefore, experimental designs should incorporate complementary measures of leukocyte activation.

What are the primary ligands for L-selectin in rat models?

L-selectin interacts with specific glycoprotein ligands strategically expressed in various tissues. In rat models, ligands for L-selectin are selectively accumulated in:

  • High endothelial (HE) cells in lymph nodes

  • White matter, neurons, cerebellar Purkinje cells, and choroid plexus in the central nervous system

  • Distal tubules and capillary blood vessels of the kidney

At the molecular level, rat L-selectin binds to several sulfated glycoproteins that can be precipitated from lymph node lysates, with molecular weights of 55-, 65-, 120-, 190-, and >250-kDa . These interactions are calcium-dependent and LECAM-1 specific . The HEV-derived cell line Ax specifically binds to rat L-selectin-IgG, making it a valuable tool for studying L-selectin-ligand interactions .

While human L-selectin specifically binds to heavily glycosylated mucin-like proteins including GlyCAM-1, CD34, and MAdCAM-1 , researchers working with rat models should characterize the specific ligands in their experimental system, as expression patterns may vary across tissues and disease states.

How do glycosulfopeptides interact with L-selectin and what structural features are critical for binding?

Glycosulfopeptides (GSPs) represent specialized L-selectin ligands with precise structural requirements for optimal binding. Synthetic glycosulfopeptides modeled after the N-terminus of PSGL-1 are recognized by recombinant L-selectin and T lymphocytes expressing native L-selectin .

Critical structural features include:

  • Sulfated tyrosine residues (TyrSO₃): At least one sulfated tyrosine is required, with Y51 being most important

  • Core-2-based O-glycans bearing sialyl Lewis x (sLex) epitope: Preferentially at T57

  • Precise spatial arrangement: A glycosulfopeptide containing three TyrSO₃ residues and a C2-SLex O-glycan at T57 (2-GSP-6) bound L-selectin with relatively high affinity (Kd ~5 μM)

The type of O-glycan significantly influences binding strength, with core-2-based O-glycans supporting stronger L-selectin binding than extended core-1 O-glycans . These findings highlight the cooperative nature of L-selectin binding, requiring both negatively charged sulfate groups and specific carbohydrate structures in a defined spatial arrangement. Minor modifications to either the peptide backbone, sulfation pattern, or glycan structure can significantly alter binding affinity.

How do L-selectin and P-selectin collaborate in leukocyte rolling?

L-selectin and P-selectin function cooperatively to mediate leukocyte rolling on endothelium, with each selectin contributing distinct but complementary roles:

  • Initial tethering: L-selectin mediates the initial capture of leukocytes from the bloodstream to the endothelium

  • Rolling stabilization: P-selectin interactions (particularly with PSGL-1) control subsequent rolling behavior and velocity

Experimental evidence supports this collaborative mechanism:

  • Blocking PSGL-1 reduced tethering by approximately 50% in mice with established P-selectin-dependent rolling

  • Combining PSGL-1 and L-selectin antibodies effectively abolished tethering

  • Anti-PSGL-1 antibody increased rolling velocity in surgically stimulated cremaster venules

  • Subsequently added L-selectin antibody did not alter rolling velocity, whereas the sLex mimetic CGP69669A caused a dramatic further velocity increase

Multiple studies indicate that L-selectin, P-selectin, and E-selectin collectively mediate the initial binding of leukocytes to endothelium at sites of tissue injury and inflammation, producing the characteristic "rolling" of leukocytes along the endothelium . This sequential and complementary action is crucial for efficient leukocyte recruitment.

What is the role of sialyl Lewis x in L-selectin binding?

Sialyl Lewis x (sLex) serves as a key recognition motif within glycan structures for L-selectin binding. L-selectin specifically binds sialylated and fucosylated oligosaccharides like sLex that are linked to glycoproteins and glycolipids .

Key features of sLex in L-selectin binding:

  • Presentation matters: sLex on core-2 O-glycans (C2-SLex) provides stronger binding to L-selectin compared to sLex on extended core-1 O-glycans

  • Necessary but not sufficient: The presence of sLex is required but not always sufficient for optimal L-selectin binding, as additional modifications like tyrosine sulfation of the carrier protein enhance binding affinity

  • Calcium dependence: L-selectin binding to sLex-bearing structures is calcium-dependent, consistent with the C-type lectin domain in L-selectin's ligand-binding region

  • Functional significance: The importance of sLex for L-selectin-mediated adhesion is demonstrated by the ability of small molecule sLex mimetics like CGP69669A to interfere with leukocyte tethering

Researchers studying L-selectin interactions should consider not only the presence of sLex but also its precise presentation (glycan core structure, density, clustering) and the context of additional modifications on the carrier molecule.

How is L-selectin involved in inflammatory models in rats?

L-selectin plays a pivotal role in rat inflammation models by mediating critical steps in leukocyte recruitment to inflammatory sites. The functional significance of L-selectin is highlighted by studies showing that L-selectin knockout mice have a 70% decrease in rolling leukocytes in various inflammation models .

In rats, recombinant L-selectin-IgG chimera (rLEC-IgG) has mapped the distribution of L-selectin ligands in various tissues, revealing their presence not only in lymphoid organs but also in kidney and central nervous system structures . This distribution suggests potential roles for L-selectin in:

  • Renal inflammation models

  • Neuroinflammation models

  • Lymphocyte homing and recirculation studies

The calcium-dependent and carbohydrate-specific nature of L-selectin binding, which can be inhibited by mannose-6-phosphate-rich polysaccharide polyphosphomannan ester , provides mechanistic insights that can inform therapeutic interventions in rat inflammation models.

For researchers using rat models of inflammation, targeting L-selectin with antibodies, recombinant chimeras, or small molecule inhibitors provides a strategy to modulate leukocyte recruitment and subsequent inflammatory responses.

What are the implications of L-selectin shedding in inflammatory disease models?

L-selectin shedding represents a critical regulatory mechanism with significant implications for inflammatory disease progression and resolution. L-selectin undergoes ectodomain shedding mediated primarily by ADAM17, resulting in the release of soluble L-selectin that can be detected in plasma/serum .

Key implications of L-selectin shedding:

  • Biomarker potential: Soluble L-selectin levels (0.7-1.5 μg per mL in healthy humans) are used as biomarkers for leukocyte activation during acute or chronic inflammation

  • Complex dynamics in disease states:

    • Increased levels in rheumatic disease (partially due to alternatively spliced variant)

    • Paradoxically decreased levels in sepsis, possibly due to adsorption to upregulated vascular ligands

  • Regulatory function: Soluble L-selectin competes with cell-associated L-selectin for ligands, potentially modulating leukocyte recruitment during inflammation

  • Self-limiting mechanism: Antibody-mediated cross-linking of L-selectin on neutrophils results in its own ectodomain shedding

For researchers studying inflammatory disease models, these findings highlight the importance of considering both membrane-bound and soluble L-selectin forms, their dynamic interrelationship, and their potentially opposing effects on leukocyte recruitment and inflammatory outcomes.

How does blockade of L-selectin affect leukocyte recruitment in various disease states?

Blockade of L-selectin has profound effects on leukocyte recruitment across various disease states, primarily by disrupting the initial tethering step in the leukocyte adhesion cascade.

Experimental evidence of L-selectin blockade effects:

  • In vitro: Antibodies against L-selectin block lymphocyte binding to lymph node high endothelial venules (HEV) on frozen sections

  • In vivo synergistic effects:

    • Combination of PSGL-1 and L-selectin antibodies effectively abolished leukocyte tethering in a cremaster muscle model

    • Anti-L-selectin antibody alone did not significantly alter leukocyte rolling flux or velocity, but showed synergistic effects when combined with PSGL-1 blockade

  • Genetic evidence: L-selectin knockout mice have a 70% decrease in rolling leukocytes in various models

These findings suggest that targeting L-selectin alone may have moderate effects, but combination approaches that block multiple adhesion pathways might achieve more complete inhibition of leukocyte recruitment. The timing of L-selectin blockade relative to disease onset may be critical, as early intervention might prevent initial leukocyte recruitment, while later blockade might have diminished efficacy once alternative adhesion mechanisms are established.

How do post-translational modifications affect L-selectin function?

Post-translational modifications profoundly influence L-selectin's functional properties, with glycosylation and tyrosine sulfation being particularly critical.

Key post-translational modifications affecting L-selectin biology:

  • L-selectin glycosylation:

    • Human L-selectin is a 74-95 kDa glycoprotein , indicating substantial glycosylation

    • Glycosylation affects protein folding, stability, and potentially binding properties

  • Modifications of L-selectin ligands:

    • Tyrosine sulfation significantly enhances L-selectin binding

    • At least one sulfated tyrosine is required for L-selectin-dependent rolling, with Y51 being the most important sulfation site

    • O-glycosylation bearing sialyl Lewis x (sLex) epitopes is essential for L-selectin recognition

    • Core-2-based O-glycans with sLex support stronger L-selectin binding than extended core-1 O-glycans with sLex

For researchers investigating L-selectin interactions, characterizing these post-translational modifications is essential, as expression systems lacking appropriate modification machinery may produce recombinant proteins with altered binding properties. Techniques such as mass spectrometry and specific glycosidase or sulfatase treatments can help determine the precise modifications present and their functional significance.

What are the signaling pathways activated downstream of L-selectin engagement?

L-selectin functions not only as an adhesion molecule but also as a signaling receptor that triggers specific intracellular pathways upon engagement. Antibody-mediated cross-linking (AMC) of L-selectin can induce various cellular responses, suggesting active signaling through its cytoplasmic domain .

Key signaling effects of L-selectin engagement:

  • T-cell signaling: L-selectin clustering can augment T-cell receptor signaling, indicating crosstalk between adhesion and activation pathways

  • Chemokine receptor modulation: AMC of L-selectin on mouse splenic T-cells and B-cells increases their responsiveness to the chemokine CCL21 via CCR7

  • Feedback regulation: In neutrophils, AMC of L-selectin results in its own ectodomain shedding, suggesting a feedback mechanism involving ADAM17 activation

While the search results don't detail all specific intracellular signaling molecules involved, research in this field has identified roles for calcium flux, mitogen-activated protein kinases (MAPKs), phosphoinositide 3-kinase (PI3K), and cytoskeletal rearrangements downstream of L-selectin engagement.

Cell type-specific differences in signaling outcomes, the influence of co-receptors, adhesion strength, and temporal dynamics of signaling events are important considerations for researchers investigating L-selectin signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.