Recombinant Rat Lamina-associated polypeptide 2, isoform beta (Tmpo)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment based on available stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmpo; Lap2; Lamina-associated polypeptide 2, isoform beta; Thymopoietin isoform beta; TP beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-452
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Tmpo
Target Protein Sequence
PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSKG PPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRPEDKDDLDVTELSNEELLE QLVRYGVNPGPIVGTTRKLYEKKLLKLREQGAESRSSTPLPTVSSSAENTRQNGSNDSDR YSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRIEHNQSYSEAGVTETEWTSGSSKGGP LQALTRESTRGSRRTPRRRVEPSQHFRVDGAVISESTPIAETIKASSNDSLVANRLTGNF KHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISAS CRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSVPMWIKMLLFAL VAGFLFLVYQAMETNQGNPFTNFLQDTKISN
Uniprot No.

Target Background

Function
Recombinant Rat Lamina-associated polypeptide 2, isoform beta (Tmpo) binds directly to lamin B1 and chromosomes in a mitotic phosphorylation-regulated manner. It plays a crucial role in nuclear envelope reassembly after mitosis and/or anchoring the nuclear lamina and interphase chromosomes to the nuclear envelope.
Gene References Into Functions
  1. LAP2α and BAF transiently localize to telomeres and specific chromatin regions during nuclear assembly. PMID: 15546916
  2. LAP2α overexpression in primary tumors correlates with tumor proliferation rate, consistent with its E2F regulation. PMID: 16760672
Database Links
Protein Families
LEM family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein. Chromosome. Note=Tightly associated with the nuclear lamina.

Q&A

What is Lamina-associated polypeptide 2, isoform beta (Tmpo) and what are its key functions?

Tmpo/LAP2β is an integral membrane protein of the inner nuclear membrane generated by alternative splicing from the LAP2 gene. This protein binds directly to lamin B1 and chromosomes in a mitotic phosphorylation-regulated manner. Its primary functions include playing an important role in nuclear envelope reassembly at the end of mitosis and anchoring of the nuclear lamina and interphase chromosomes to the nuclear envelope .

Functionally, LAP2β contributes to maintaining nuclear architecture through its interactions with the nuclear lamina, which forms a meshwork underlying the inner nuclear membrane. This structural role is essential for proper nuclear organization and stability. LAP2β is part of a protein complex containing both A- and B-type lamins as revealed through in vitro binding experiments with GST-fusion proteins and immunoprecipitation studies .

How does Tmpo/LAP2β differ structurally and functionally from LAP2α?

While both proteins originate from the same gene through alternative splicing, they exhibit significant differences in structure, localization, and function:

FeatureLAP2βLAP2α
Cellular localizationIntegral inner nuclear membrane proteinNucleoplasmic protein
Lamin interactionPrimarily lamin BPrimarily lamin A/C
Membrane associationTransmembrane domain presentNo transmembrane domain
Functional roleNuclear envelope structureTranscriptional regulation, cell cycle control

LAP2α, unlike LAP2β, is not required for MRTF-A nuclear localization but is essential for the recruitment of MRTF-A to its target genes . LAP2α has been reported to regulate cell proliferation by affecting the activity of retinoblastoma protein (pRb) in tissue progenitor cells . LAP2α preferentially interacts with hypophosphorylated pRb and is required for pRb anchorage in the nucleus, promoting pRb-mediated repression of target genes .

What techniques are most effective for detecting and quantifying Tmpo expression in rat tissues?

Several methodological approaches are available for studying Tmpo expression in rat tissues:

  • ELISA-based detection: The Rat Lamina-Associated Polypeptide 2 Isoform Beta (TMPO) ELISA Kit allows for accurate quantification of TMPO levels in rat samples, including serum, plasma, and cell culture supernatants. This method offers a detection range of 0.78-50 ng/mL with a sensitivity of 0.4 ng/mL .

  • Immunofluorescence microscopy: This technique enables visualization of Tmpo localization within cells using specific antibodies. For optimal results, fixation with 4% paraformaldehyde followed by permeabilization with 0.1% Triton X-100 is recommended.

  • Western blot analysis: For protein level detection and semi-quantitative analysis, western blotting using specific anti-Tmpo antibodies provides reliable results. Sample preparation should include careful nuclear fraction isolation to ensure proper detection of this nuclear envelope protein.

  • RT-qPCR: For mRNA expression analysis, reverse transcription followed by quantitative PCR using Tmpo-specific primers allows for sensitive detection of transcript levels across different tissues or experimental conditions.

What is known about the conservation of Tmpo/LAP2β across species?

The lamina-binding site of LAP2β demonstrates remarkable evolutionary conservation across vertebrates. Studies have identified a highly conserved 36 amino acid sequence located in the carboxyterminal region of LAP2β that is part of the lamina-binding domain . This conservation suggests fundamental importance to nuclear structure and function.

In vitro experiments with GFP fusion proteins comprising only the carboxyterminal 135 amino acids of Xenopus LAP2β (XLAP2β) or the comparable region of zebrafish LAP2β were sufficient for targeting to the nuclear envelope and in vivo formation of protein complexes . GFP-LAP2β fusion proteins from Xenopus, zebrafish, and rat containing this conserved sequence competed with endogenous LAP2 for binding sites in the lamina, further demonstrating the functional conservation of this domain .

What molecular mechanisms underlie Tmpo/LAP2β interactions with the nuclear lamina?

The interaction between Tmpo/LAP2β and the nuclear lamina involves specific binding domains and molecular mechanisms:

  • Lamina-binding domain: The carboxyterminal region of LAP2β contains a highly conserved 36 amino acid sequence that mediates binding to the nuclear lamina . This domain facilitates interactions with both A- and B-type lamins, suggesting a bridging function between different lamin polymers.

  • Complex formation: LAP2β is part of a protein complex containing both A- and B-type lamins as demonstrated through GST-fusion protein binding experiments and immunoprecipitation studies . This suggests that LAP2β may serve as an adapter protein connecting different components of the nuclear envelope.

  • Competitive binding: GFP-LAP2β fusion proteins containing the conserved lamina-binding domain compete with endogenous LAP2 for binding sites in the lamina . This competition indicates specific, saturable binding sites within the nuclear lamina structure.

  • Phosphorylation regulation: LAP2β binds to chromosomes in a mitotic phosphorylation-regulated manner , suggesting that post-translational modifications play a crucial role in modulating LAP2β-lamina interactions during the cell cycle.

For studying these interactions, researchers should consider using techniques such as proximity ligation assays, fluorescence resonance energy transfer (FRET), or co-immunoprecipitation followed by mass spectrometry to identify binding partners.

How does LAP2β contribute to nuclear envelope dynamics during cell division?

LAP2β plays critical roles in nuclear envelope dynamics during mitosis and cell division:

  • Nuclear envelope reassembly: LAP2β is important for nuclear envelope reassembly at the end of mitosis . During mitotic nuclear envelope breakdown, LAP2β is phosphorylated, which regulates its association with chromatin and lamins.

  • Chromosome tethering: LAP2β binds directly to chromosomes in a mitotic phosphorylation-regulated manner , suggesting a role in ensuring proper chromosome positioning during nuclear envelope reformation.

  • Lamin organization: Through its interactions with both A- and B-type lamins, LAP2β contributes to the proper organization of the nuclear lamina during nuclear envelope reassembly .

Experimental approaches to study these dynamics include:

  • Live-cell imaging with fluorescently tagged LAP2β to track its localization during mitosis

  • Phospho-specific antibodies to detect cell-cycle dependent modifications

  • Cell synchronization techniques to enrich for mitotic cells

  • Electron microscopy to visualize nuclear envelope ultrastructure

What is the relationship between Tmpo/LAP2 proteins and transcriptional regulation?

LAP2 proteins, particularly LAP2α, play significant roles in transcriptional regulation through several mechanisms:

  • MRTF-A/SRF pathway regulation: LAP2α is a direct binding partner of Myocardin-related transcription factor A (MRTF-A) and is required for efficient expression of MRTF-A/SRF target genes . LAP2α facilitates the recruitment of MRTF-A to its target genes, representing a novel mechanism for regulating MRTF-A activity within the nucleus.

  • Retinoblastoma protein (pRb) activity modulation: LAP2α preferentially interacts with hypophosphorylated pRb and is required for pRb anchorage in the nucleus . Overexpression of LAP2α causes down-regulation of E2F-dependent reporter gene activity and represses endogenous E2F target genes, suggesting that LAP2α promotes pRb-mediated repression of target genes .

  • Cell cycle regulation: LAP2α and A-type lamins can activate pRb repressor activity and thereby act in an anti-proliferative manner . Fibroblasts derived from LAP2α-deficient mice showed impaired pRb repressor activity, upregulated E2F/pRb target gene expression, and delayed cell cycle exit upon contact inhibition .

For studying these relationships, researchers should consider chromatin immunoprecipitation (ChIP) assays, reporter gene assays, and co-immunoprecipitation studies to detect protein-protein interactions in transcriptional complexes.

What methodological considerations are important when designing Tmpo/LAP2β knockdown or knockout experiments?

When designing knockdown or knockout experiments for Tmpo/LAP2β, researchers should consider the following methodological aspects:

  • Choice of model system:

    • Cell lines: A6 cells (Xenopus kidney epithelial cells) have been established as a good model system for studying LAP2β functions

    • Animal models: Consider the phenotypic effects observed in LAP2α knockout mice, including effects on progenitor cell proliferation in tissues

  • Knockdown approaches:

    • siRNA/shRNA: Design targeting conserved regions of Tmpo transcript

    • CRISPR-Cas9: Target early exons to ensure complete protein loss

    • Verify knockdown efficiency by both RT-qPCR and Western blot

  • Functional assays:

    • Nuclear envelope structure: Immunofluorescence for lamin organization

    • Cell migration: Wound healing assays (LAP2α is required for serum-induced cell migration)

    • Cell cycle progression: Flow cytometry and BrdU incorporation

    • Gene expression: RNA-seq or targeted qPCR for MRTF-A/SRF target genes

  • Controls and rescue experiments:

    • Include wild-type cells as positive controls

    • Perform rescue experiments with recombinant Tmpo to confirm specificity

    • Consider using mutant versions (e.g., with deleted lamina-binding domain) for structure-function studies

  • Potential confounding factors:

    • Compensatory upregulation of other LAP2 isoforms

    • Effects on multiple cellular processes due to disruption of nuclear architecture

    • Cell-type specific phenotypes requiring tissue-specific approaches

How can researchers effectively study the role of Tmpo/LAP2β in disease models like dilated cardiomyopathy?

Tmpo mutations have been associated with dilated cardiomyopathy 1T , making it an important protein for cardiac disease research. Methodological approaches for studying Tmpo in disease contexts include:

  • Genetic screening approaches:

    • Next-generation sequencing/massively parallel sequencing for mutation identification

    • Deletion/duplication analysis to detect larger genomic alterations

  • Functional characterization of disease-associated mutations:

    • CRISPR-Cas9 knock-in of specific mutations in cellular or animal models

    • Assessment of protein stability, localization, and interaction partners

    • Analysis of nuclear envelope structure and integrity

    • Evaluation of cardiac-specific gene expression patterns

  • Cardiac-specific models:

    • Induced pluripotent stem cell (iPSC)-derived cardiomyocytes from patients or with engineered mutations

    • Cardiac-specific conditional knockout mouse models

    • Ex vivo heart preparations to assess functional parameters

  • Molecular pathway analysis:

    • Examination of interactions with cardiac-specific proteins

    • Analysis of mechanotransduction pathways that might be disrupted

    • Evaluation of calcium handling and contractile properties

  • Therapeutic screening platforms:

    • High-throughput screens for compounds that rescue phenotypes

    • Gene therapy approaches to correct or compensate for mutations

    • Small molecule stabilizers of protein-protein interactions

What are the optimal sample preparation methods for studying Tmpo/LAP2β in different experimental contexts?

Sample preparation is critical for obtaining reliable results when studying nuclear envelope proteins like Tmpo/LAP2β:

  • For protein extraction and analysis:

    • Nuclear fractionation is essential to enrich for nuclear envelope proteins

    • Use of non-ionic detergents (e.g., NP-40 or Triton X-100) at low concentrations for membrane protein solubilization

    • Consider cross-linking approaches to preserve protein-protein interactions

    • For Western blotting, include phosphatase inhibitors if studying phosphorylation status

  • For immunofluorescence microscopy:

    • Fixation with 4% paraformaldehyde preserves nuclear structure

    • Permeabilization with 0.1-0.5% Triton X-100 allows antibody access to nuclear proteins

    • Consider pre-extraction protocols to remove soluble nucleoplasmic proteins for clearer visualization of nuclear envelope components

  • For chromatin immunoprecipitation (ChIP):

    • Optimize crosslinking conditions (typically 1% formaldehyde for 10 minutes)

    • Ensure complete nucleus lysis for chromatin accessibility

    • Use sonication parameters that generate 200-500 bp DNA fragments

    • Include appropriate negative controls (IgG, non-target regions)

  • For ELISA-based detection:

    • Sample preparation should follow the guidelines provided with the Rat TMPO ELISA Kit

    • Appropriate sample dilutions may be necessary to ensure measurements fall within the detection range (0.78-50 ng/mL)

How can researchers effectively use recombinant Tmpo/LAP2β in functional studies?

Recombinant Tmpo/LAP2β can be utilized in various experimental approaches:

  • Protein-protein interaction studies:

    • In vitro binding assays using GST-tagged or His-tagged recombinant Tmpo

    • Surface plasmon resonance (SPR) to determine binding kinetics with lamins or other partners

    • Pull-down assays with cell lysates to identify novel interaction partners

  • Structural studies:

    • Crystallography or cryo-EM analysis of the conserved lamina-binding domain

    • Circular dichroism to assess secondary structure changes upon binding to partners

    • Nuclear magnetic resonance (NMR) for studying dynamic interactions

  • Functional rescue experiments:

    • Transfection of recombinant protein into knockout or knockdown cells

    • Construction of domain deletion mutants to identify functional regions

    • Introduction of disease-associated mutations to assess functional consequences

  • Biochemical assays:

    • Chromatin binding assays to assess DNA/chromatin interaction capabilities

    • In vitro reconstitution of nuclear envelope assembly

    • Phosphorylation assays to identify regulatory sites

When designing constructs, researchers should consider preserving the highly conserved 36 amino acid sequence in the carboxyterminal region that is part of the lamina-binding domain .

How should researchers interpret conflicting results in Tmpo/LAP2 studies across different model systems?

When encountering conflicting results in Tmpo/LAP2 studies across different model systems, researchers should consider several factors:

  • Isoform specificity: LAP2 exists in multiple isoforms (α, β, etc.) with distinct functions. Ensure that observed phenotypes are attributed to the correct isoform. For example, LAP2α is involved in MRTF-A recruitment to target genes , while LAP2β primarily functions in nuclear envelope structure .

  • Species differences: Despite high conservation of the lamina-binding domain , there may be species-specific interactions or regulatory mechanisms. Cross-species comparisons should acknowledge potential differences in protein partners or regulatory pathways.

  • Cell type specificity: LAP2 proteins may have cell type-specific functions. For instance, LAP2α affects proliferation differently in various progenitor cell populations (paw epidermis, colon crypts, skeletal muscle) .

  • Methodological variations:

    • Antibody specificity may vary across studies

    • Knockdown efficiency might differ between approaches

    • Overexpression levels might lead to artifacts

    • Timing of analyses during cell cycle may affect results

  • Redundancy and compensation: Other LEM-domain proteins might compensate for LAP2 loss in some systems but not others, contributing to phenotypic differences.

To address these challenges, researchers should:

  • Clearly specify the LAP2 isoform being studied

  • Include multiple methodological approaches to confirm findings

  • Validate key findings across different cell types or species

  • Consider temporal dynamics, especially for cell cycle-regulated processes

  • Perform combinatorial knockdowns to address redundancy

What are the most significant recent advances in understanding Tmpo/LAP2β function and regulation?

Recent significant advances in understanding Tmpo/LAP2β function and regulation include:

  • Novel role in transcriptional regulation: The discovery that LAP2α is a direct binding partner of MRTF-A and required for efficient expression of MRTF-A/SRF target genes represents a significant advancement in understanding how LAP2 proteins contribute to gene regulation . This finding expands the role of LAP2 proteins beyond nuclear structure maintenance.

  • Mechanistic insights into gene regulation: LAP2α has been shown to facilitate the recruitment of MRTF-A to its target genes, providing a mechanistic explanation for its role in transcriptional regulation . This regulatory step takes place prior to MRTF-A chromatin binding, as LAP2α neither interacts with nor specifically influences active histone marks on MRTF-A/SRF target genes.

  • Link to cell migration: LAP2α has been demonstrated to be required for serum-induced cell migration , connecting nuclear envelope proteins to cytoskeletal dynamics and cell motility.

  • Role in disease pathogenesis: The association of TMPO mutations with dilated cardiomyopathy 1T has highlighted the importance of these proteins in cardiac function and disease.

  • Evolutionary conservation insights: The identification of highly conserved functional domains, particularly the 36 amino acid lamina-binding domain that has been preserved throughout vertebrate evolution , underscores the fundamental importance of these proteins in nuclear function.

These advances collectively point to Tmpo/LAP2 proteins as multifunctional components of the nuclear envelope with roles extending beyond structural maintenance to include transcriptional regulation, cell migration, and disease pathogenesis.

What are the most promising unexplored aspects of Tmpo/LAP2β biology for future investigation?

Several promising areas remain underexplored in Tmpo/LAP2β research:

  • Tissue-specific functions: While some studies have examined LAP2α's role in tissue progenitor cells , comprehensive analysis of tissue-specific functions of LAP2β remains limited. Future studies could focus on conditional knockout models to explore tissue-specific phenotypes.

  • Post-translational modifications: LAP2β binding to chromosomes is regulated by mitotic phosphorylation , but the full spectrum of post-translational modifications and their functional significance remains to be elucidated. Phosphoproteomics approaches could identify novel regulatory sites.

  • Role in chromatin organization: The contribution of LAP2β to three-dimensional chromatin organization and gene expression regulation deserves further investigation, potentially through Hi-C or similar chromatin conformation capture techniques.

  • Interaction with non-lamin partners: While interactions with lamins are well-documented , the full interactome of LAP2β likely includes additional proteins that may mediate its various functions. Systematic proteomic approaches could identify novel interaction partners.

  • Therapeutic targeting potential: Given the association with dilated cardiomyopathy , exploring whether modulating LAP2β activity could have therapeutic benefits represents an important translational research direction.

  • Mechanobiology connections: How LAP2β contributes to nuclear mechanotransduction and force transmission between the cytoskeleton and nucleus remains poorly understood and could be explored through biophysical approaches.

  • Aging-related changes: Changes in nuclear envelope composition and structure are associated with aging, but specific alterations in LAP2β during aging and their functional consequences have not been thoroughly investigated.

How might emerging technologies advance our understanding of Tmpo/LAP2β biology?

Emerging technologies offer exciting opportunities to deepen our understanding of Tmpo/LAP2β biology:

  • Cryo-electron tomography: This technique can provide unprecedented structural insights into the organization of LAP2β within the native nuclear envelope at near-atomic resolution.

  • Live-cell super-resolution microscopy: Techniques like PALM, STORM, or lattice light-sheet microscopy could reveal dynamic LAP2β behaviors during cell cycle progression or in response to mechanical stimuli with nanometer precision.

  • Proximity labeling approaches: BioID or APEX2-based proximity labeling could identify proteins that transiently interact with LAP2β in living cells, potentially revealing novel functional partners.

  • Single-cell multi-omics: Combining single-cell transcriptomics, proteomics, and epigenomics could reveal how LAP2β contributes to cell-to-cell variability in nuclear envelope composition and gene expression.

  • CRISPR screening technologies: Genome-wide or targeted CRISPR screens could identify genetic interactions with LAP2β, revealing functional redundancies or synthetic lethal relationships.

  • Organoid models: Patient-derived organoids carrying TMPO mutations could provide physiologically relevant models to study LAP2β's role in tissue development and disease.

  • Computational modeling: Molecular dynamics simulations and integrative modeling approaches could predict how LAP2β contributes to nuclear envelope mechanics and chromatin organization.

  • Spatial transcriptomics: These techniques could reveal how LAP2β's association with specific chromatin domains influences local gene expression patterns within the nucleus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.