Recombinant Rat Leucine-rich repeat-containing protein 3 (Lrrc3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Lrrc3; Leucine-rich repeat-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-257
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Lrrc3
Target Protein Sequence
CPQSCQCPDHAGAVAVHCSSRGLQEIPRDIPANTVLLKLDANRISRVPNGAFQHLPQLRE LDLSHNAIEAIGPAAFSGLAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECA LQEALWELKLDPDSVDEIACHTSAQEQFVGKPLIQVLDSGASFCSTHRKTTDVAMLVTMF GWFTMVIAYVVYYVRHNQEDARRHLEYLKSLPSAPVSKEPLSPVP
Uniprot No.

Target Background

Database Links
Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is Lrrc3 gene expression regulated in rat tissues?

Rat Lrrc3 gene expression is primarily regulated through the Ras-MAPK signaling pathway . Experimental evidence demonstrates that:

  • Stable expression of constitutively active forms of Ras (H-Ras(V12) or v-H-Ras) leads to a two- to fourfold increase in rNLRR-3 mRNA in rat normal fibroblasts (3Y1) .

  • When cells expressing H-Ras(V12) are treated with MAPK kinase inhibitors (U0126, PD98059), suppression of rNLRR-3 mRNA correlates with a reduction in MAPK activity .

  • Epidermal growth factor (EGF) elevates rNLRR-3 gene expression approximately 4 hours after stimulation of normal fibroblasts .

  • MAPK inhibitor U0126 completely suppresses the EGF-induced expression of rNLRR-3 mRNA together with abrogation of MAPK phosphorylation .

  • Chemical agents can also influence expression - for example, benzo[a]pyrene has been shown to decrease Lrrc3 expression while affecting its methylation patterns .

This regulation pathway suggests that Lrrc3 expression responds to growth factor stimulation and cellular stress conditions through established signal transduction mechanisms.

What are the optimal conditions for reconstitution and storage of recombinant rat Lrrc3?

Based on protocols established for similar recombinant LRR proteins, the following guidelines should be followed:

Reconstitution Protocol:

  • Recombinant rat Lrrc3 is typically lyophilized from a 0.2 μm filtered solution in Tris-based buffer with 50% glycerol .

  • Reconstitute at 100 μg/mL in sterile PBS or as specifically recommended for your preparation .

  • For carrier-free versions, avoid adding BSA or other carrier proteins that might interfere with downstream applications .

Storage Recommendations:

  • Store lyophilized protein at -20°C for extended storage periods.

  • For reconstituted protein, store working aliquots at 4°C for up to one week.

  • For long-term storage of reconstituted protein, prepare small aliquots and store at -20°C or -80°C.

  • Avoid repeated freeze-thaw cycles as they can compromise protein activity and integrity .

Critical Considerations:

  • Some preparations might include specific buffer requirements optimized for the protein's stability.

  • If using for cell culture applications, ensure sterile reconstitution techniques.

  • Check purity assessments (typically >95% by SDS-PAGE) before experimental use .

What experimental approaches can be used to study Lrrc3's role in the Ras-MAPK signaling pathway?

Several methodologies can be employed to investigate Lrrc3's involvement in Ras-MAPK signaling:

1. Phosphorylation Analysis:

  • Western blotting using phospho-specific antibodies against ERK1/2 to measure MAPK activation in cells expressing or depleted of Lrrc3 .

  • Time-course analysis following EGF stimulation (0.01-10 ng/mL) to determine the kinetics of MAPK activation in the presence or absence of Lrrc3 .

2. Gene Expression Manipulation:

  • Use siRNA or CRISPR/Cas9 to knockdown or knockout Lrrc3 expression, followed by assessment of downstream MAPK-dependent gene expression .

  • Overexpression studies using full-length Lrrc3 or truncated variants (particularly those lacking the C-terminal region) to identify functional domains .

3. Protein-Protein Interaction Studies:

  • Co-immunoprecipitation assays to detect interactions between Lrrc3 and components of the clathrin-mediated endocytosis machinery, such as β-adaptin .

  • GST pull-down experiments can confirm direct binding between Lrrc3 and potential interacting partners .

  • Fluorescence microscopy using GFP-tagged Lrrc3 to track its internalization upon EGF stimulation .

4. Pharmacological Intervention:

  • Use specific inhibitors of the MAPK pathway (U0126, PD98059) or clathrin-mediated endocytosis blockers to assess their impact on Lrrc3-dependent signaling .

Example Experimental Design Table:

Experimental ApproachMethodologyKey ReadoutsControls
MAPK ActivationWestern blot for phospho-ERKBand intensity at 42/44 kDaTotal ERK levels
Endocytosis AssessmentFluorescence microscopy with dual-labeled EGF and Lrrc3Colocalization coefficientC-terminal deleted Lrrc3
Gene ExpressionRT-qPCRFold change in Lrrc3 mRNAGAPDH or β-actin
Binding AssaysGST pull-downPresence of interacting proteinsGST-only control

How can truncated Lrrc3 constructs be designed to study domain-specific functions?

Designing domain-specific truncations requires careful consideration of the protein's structural elements:

Strategic Approach to Truncation Design:

  • C-terminal Truncations:

    • Create a construct lacking the C-terminal 30 amino acids containing clathrin-mediated endocytosis motifs, similar to the approach used with NLRR-3 .

    • This would be critical for investigating the role of Lrrc3 in receptor internalization and signal transduction.

  • LRR Domain Truncations:

    • Generate constructs with systematic deletion of individual LRR domains to identify which specific repeats are essential for protein-protein interactions.

    • For example, removing LRRs 1-3, 4-6, or 7-10 individually to map binding interfaces.

  • N-terminal Signal Sequence Modification:

    • Design constructs with and without the signal sequence to control subcellular localization.

    • Add alternative trafficking signals to redirect the protein to specific cellular compartments.

Expression Vector Selection:

  • For mammalian expression, vectors with CMV promoters provide robust expression.

  • For bacterial expression, pET systems with T7 promoters are recommended for high yield.

  • Consider adding epitope tags (His, FLAG, or GST) at positions that won't interfere with functional domains.

Functional Validation Methods:

  • Compare phosphorylation of MAPK between wild-type and truncated constructs using Western blots.

  • Assess subcellular localization using confocal microscopy.

  • Perform domain-specific pull-down assays to identify interacting partners.

What expression systems are most effective for producing functional recombinant rat Lrrc3?

The choice of expression system significantly impacts the yield, folding, and post-translational modifications of recombinant Lrrc3:

Comparison of Expression Systems:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid expressionLacks post-translational modifications, potential folding issuesStructural studies, antibody production
Mammalian Cells (HEK293, CHO)Native-like glycosylation, proper foldingLower yield, higher cost, longer production timeFunctional assays, protein-protein interaction studies
Insect Cells (Sf9, Hi5)High yield, some post-translational modificationsNot identical to mammalian glycosylationCompromise between yield and functionality
Cell-Free SystemsRapid, avoids cellular toxicityLimited post-translational modificationsInitial screening, quick production of variants

Optimization Strategies:

  • For E. coli Expression:

    • Use fusion tags like MBP or SUMO to enhance solubility.

    • Express at lower temperatures (16-20°C) to improve folding.

    • Consider expressing only the extracellular domain to avoid transmembrane region-associated aggregation.

  • For Mammalian Expression:

    • Optimize codon usage for rat proteins.

    • Use strong promoters (CMV) for high expression.

    • Add secretion signals for extracellular domain expression.

  • For Either System:

    • Implement affinity tags (His, FLAG) for simplified purification.

    • Consider including protease cleavage sites to remove tags post-purification.

Based on available data, most commercial preparations of recombinant rat Lrrc3 utilize E. coli expression systems for the production of research-grade protein .

How can the purity and functionality of recombinant rat Lrrc3 be validated for experimental use?

A multi-faceted approach should be employed to ensure both purity and biological activity:

Purity Assessment Methods:

  • SDS-PAGE Analysis:

    • Run the purified protein on 10-12% gels under both reducing and non-reducing conditions.

    • Standard should show >95% purity with minimal contaminating bands .

    • Silver staining can detect even minor impurities.

  • Western Blot Analysis:

    • Use anti-Lrrc3 antibodies to confirm identity.

    • Check for degradation products or aggregates.

  • Mass Spectrometry:

    • Peptide mass fingerprinting to confirm protein identity.

    • LC-MS/MS for comprehensive assessment of purity and potential modifications.

Functional Validation Assays:

  • Binding Studies:

    • Surface Plasmon Resonance (SPR) to test interaction with known binding partners.

    • ELISA-based binding assays with potential interacting proteins.

  • Signal Transduction Assays:

    • Assess the ability of recombinant Lrrc3 to enhance MAPK phosphorylation in cell-based assays .

    • Compare the activity of full-length vs. truncated versions.

  • Structural Integrity:

    • Circular Dichroism (CD) spectroscopy to evaluate secondary structure.

    • Thermal shift assays to assess protein stability.

  • Endocytosis Assays:

    • If using full-length or membrane-associated constructs, test their ability to participate in clathrin-mediated endocytosis .

    • Co-localization studies with endocytic markers.

Critical Quality Attributes Table:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE≥95%
IdentityWestern Blot & MSPositive confirmation
EndotoxinLAL Assay≤1 EU/μg protein
BioactivityMAPK phosphorylation≥70% of reference standard
AggregationSEC-HPLC≤5% aggregates
StabilityThermal shiftTm within ±2°C of reference

How does Lrrc3 interact with the EGF receptor and clathrin-mediated endocytosis machinery?

Based on studies of the related protein NLRR-3, Lrrc3 likely plays a significant role in receptor trafficking and signal amplification through the following mechanisms:

Interaction Mechanisms:

  • Receptor Complex Formation:

    • Lrrc3 may associate with EGF receptors upon ligand binding, potentially through its leucine-rich repeat domains .

    • This association could stabilize active receptor complexes or influence their spatial distribution on the cell membrane.

  • Adaptor Protein Recruitment:

    • The C-terminal region of Lrrc3 likely contains endocytosis motifs that interact with clathrin adaptor proteins, particularly β-adaptin .

    • This interaction facilitates the recruitment of the clathrin machinery to activated receptor complexes.

  • Endocytic Vesicle Formation:

    • By bridging between receptors and endocytic machinery, Lrrc3 may enhance the efficiency of clathrin-coated pit formation and vesicle budding .

    • This function would be dependent on the intact C-terminal domain, as deletion of this region in NLRR-3 reduces internalization efficiency .

Experimental Evidence from Related Proteins:

  • Green fluorescent protein-tagged NLRR-3 localizes at the plasma membrane and is efficiently internalized in COS-7 cells .

  • Internalization of a C-terminal-deleted version is significantly less efficient .

  • Immunoprecipitation and GST pull-down experiments confirm the presence of clathrin-adaptor protein complexes containing NLRR-3 in brain lysates .

  • Affinity column chromatography reveals that the C-terminal region of NLRR-3 interacts with β-adaptin .

This suggests a model where Lrrc3 potentiates Ras-MAPK signaling by facilitating internalization of EGF receptors in clathrin-coated vesicles, which is critical for sustained MAPK activation from endosomal compartments.

How does rat Lrrc3 compare structurally and functionally to its human and mouse orthologs?

Comparative analysis reveals both conserved and divergent features across species:

Sequence Homology:

  • Rat Lrrc3 shares high sequence similarity with mouse Lrrc3 (approximately 90-95% amino acid identity) based on comparative analysis of related LRR proteins .

  • Human LRRC3 shares approximately 75-85% amino acid identity with the rat ortholog, with greater conservation in the LRR domains than in the C-terminal region .

Domain Conservation:

  • The leucine-rich repeat domains show the highest conservation across species, reflecting their critical role in protein-protein interactions .

  • The N-terminal signal sequence and leucine-rich repeat N-terminal domain bordered by conserved cysteines are highly conserved features .

  • The transmembrane domain shows moderate conservation.

  • The C-terminal cytoplasmic region displays more variation, suggesting species-specific regulation or interaction partners.

Functional Conservation:

  • All orthologs appear to be involved in the Ras-MAPK signaling pathway .

  • The human ortholog LRRC3/NLRR-3 functions similarly in EGF receptor trafficking and signal amplification .

  • Expression patterns show some species-specific differences, particularly in developmental timing and tissue distribution.

Regulatory Elements:

  • Promoter regions show less conservation than coding sequences, suggesting species-specific regulation.

  • Response to chemical agents and stress conditions appears to be a conserved feature .

Experimental Considerations:
When using rat Lrrc3 as a model for human conditions, researchers should be aware of these species-specific differences and validate key findings across species whenever possible.

What advanced bioinformatic approaches can identify novel potential interacting partners of Lrrc3?

Computational strategies can significantly accelerate the discovery of Lrrc3 interaction networks:

Advanced Bioinformatic Methodologies:

  • Structural Prediction and Docking:

    • Use AlphaFold2 or RoseTTAFold to generate high-confidence structural models of rat Lrrc3.

    • Perform protein-protein docking simulations with known components of the MAPK pathway and endocytic machinery.

    • Calculate binding energies and interface characteristics to prioritize potential interactions.

  • Network Analysis:

    • Apply weighted gene co-expression network analysis (WGCNA) to transcriptomic datasets to identify genes whose expression patterns correlate with Lrrc3.

    • Use STRING, BioGRID, and other protein interaction databases to build networks of known interactors of Lrrc3 and its homologs.

    • Apply network propagation algorithms to predict new nodes (proteins) likely to interact with Lrrc3.

  • Sequence-Based Prediction:

    • Identify conserved linear motifs in Lrrc3 using tools like ELM (Eukaryotic Linear Motif) that could mediate specific protein-protein interactions.

    • Use domain-based interaction prediction to identify proteins with complementary interacting domains.

    • Apply machine learning approaches trained on known LRR protein interactions to predict novel partners.

  • Evolutionary Analysis:

    • Perform phylogenetic profiling to identify proteins that co-evolved with Lrrc3.

    • Analyze patterns of correlated mutations between Lrrc3 and potential partners (direct coupling analysis).

Validation Strategy:

After computational prediction, a tiered experimental validation approach should be implemented:

  • Initial Screening:

    • Co-immunoprecipitation coupled with mass spectrometry.

    • Proximity labeling approaches (BioID, APEX) with Lrrc3 as the bait.

  • Confirmation:

    • Direct binding assays with purified proteins.

    • FRET or BRET assays for interaction in living cells.

  • Functional Relevance:

    • siRNA knockdown of identified partners to assess impact on Lrrc3 function.

    • Mutagenesis of predicted interaction interfaces.

This integrated computational and experimental approach can efficiently expand our understanding of the Lrrc3 interactome and reveal new functional roles in cellular signaling networks.

What evidence suggests involvement of Lrrc3 in pathological conditions, and how can this be experimentally investigated?

While direct evidence for rat Lrrc3 in disease models is limited, related LRR proteins have established pathological connections that suggest potential roles:

Potential Disease Associations:

  • Neurodevelopmental Disorders:

    • Related LRR proteins like LRRTM3 have been implicated in CNS development and maintenance .

    • LRRTM3 promotes processing of amyloid-precursor protein by BACE1 and is a positional candidate gene for late-onset Alzheimer's disease .

  • Cancer:

    • Ras-MAPK pathway dysregulation is a hallmark of many cancers, and Lrrc3's role in this pathway suggests potential involvement .

    • The original isolation of rNLRR-3 from fibrosarcoma cells overexpressing c-Ha-ras indicates a possible connection to oncogenic transformation .

  • Inflammatory Conditions:

    • LRR domains are common in innate immune receptors, suggesting potential immunomodulatory functions.

    • Chemical sensitivity of Lrrc3 expression may indicate roles in environmental stress responses .

Experimental Approaches to Investigate Disease Relevance:

  • Animal Models:

    • Generate Lrrc3 knockout or conditional knockout rats using CRISPR/Cas9.

    • Analyze phenotypes related to neural development, oncogenesis, and inflammatory responses.

    • Create transgenic models overexpressing Lrrc3 to identify gain-of-function effects.

  • Cell-Based Disease Models:

    • Use patient-derived cell lines or induced pluripotent stem cells (iPSCs) to examine Lrrc3 expression and function in disease contexts.

    • Apply CRISPR/Cas9 editing to model disease-associated variants.

  • Expression Analysis in Disease Tissues:

    • Perform immunohistochemistry and in situ hybridization in tissues from disease models or patient samples.

    • Conduct transcriptomic and proteomic profiling to identify altered Lrrc3 expression or interaction networks.

  • Functional Studies:

    • Explore how Lrrc3 modulation affects cellular processes relevant to disease, such as:

      • Amyloid-beta processing (Alzheimer's disease)

      • Cell proliferation and migration (cancer)

      • Inflammatory signaling (chronic inflammation)

  • Therapeutic Modulation:

    • Test whether targeting Lrrc3 expression or function can modify disease progression in relevant models.

    • Develop tools like function-blocking antibodies or small molecule inhibitors targeting Lrrc3 interactions.

Research Design Considerations:

When designing disease-focused experiments, researchers should:

  • Include appropriate positive and negative controls

  • Use multiple experimental approaches to confirm findings

  • Validate results across different model systems

  • Consider species-specific differences when translating findings

What are common technical challenges when working with recombinant Lrrc3 and how can they be addressed?

Researchers working with recombinant Lrrc3 may encounter several technical obstacles:

Challenge 1: Low Expression Yields

Solutions:

  • Optimize codon usage for the expression system being used.

  • Consider expressing only the extracellular domain to avoid transmembrane region-associated toxicity.

  • Test different fusion tags (MBP, SUMO, Trx) to improve solubility.

  • Lower induction temperature to 16-18°C for E. coli expression.

  • Use specialized expression strains designed for membrane or difficult proteins.

Challenge 2: Protein Aggregation

Solutions:

  • Include appropriate detergents for membrane-associated constructs (e.g., 0.1% DDM, CHAPS, or Triton X-100).

  • Incorporate stabilizing agents like glycerol (10-20%) in buffers.

  • Perform systematic buffer optimization using thermal shift assays.

  • Consider on-column refolding during purification.

  • Use size exclusion chromatography as a final purification step to remove aggregates.

Challenge 3: Loss of Functional Activity

Solutions:

  • Minimize freeze-thaw cycles by preparing single-use aliquots.

  • Add protease inhibitors during purification and storage.

  • Store protein with carrier BSA (except for carrier-free applications) .

  • Validate function immediately after purification as a baseline.

  • Consider adding stabilizing ligands if known binding partners exist.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.