Recombinant Rat Leukocyte cell-derived chemotaxin 1 (Lect1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Cnmd; Chmi; Lect1; Leukocyte cell-derived chemotaxin 1; Chondromodulin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
215-334
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Cnmd
Target Protein Sequence
EVVRSSAPSTTRRPHSEPRGNAGPGRLSNRTRPSVQDDEEPFNPDNPYHQQEGESMTFDP RLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVVMPCSWWVARILGMV
Uniprot No.

Target Background

Function
Recombinant Rat Leukocyte cell-derived chemotaxin 1 (Lect1) is a bifunctional growth regulator. It stimulates chondrocyte growth in the presence of basic fibroblast growth factor (FGF), yet inhibits vascular endothelial cell growth. It may contribute to rapid cartilage growth and vascular invasion preceding cartilage-to-bone replacement during endochondral bone development. Lect1 inhibits in vitro tube formation and endothelial cell mobilization, functioning as an antiangiogenic factor in cardiac valves to suppress neovascularization.
Gene References Into Functions
  1. This research elucidates the molecular mechanism by which ChM-I induces MSC differentiation into chondrocytes. PMID: 28263889
  2. Intact 20-25 kDa ChM-I resides within the extracellular matrix of avascular cartilage zones, but is inactivated by N-terminal proteolytic cleavage in the growth-plate cartilage's hypertrophic zone. PMID: 24710035
  3. This study analyzed Chm-1 expression in articular cartilage and compared it to that in the growth plate. PMID: 14527163
  4. In experimental uremia, growth cartilage expansion does not stem from increased or persistent ChM-I expression or reduced VEGF expression at the cartilage-metaphyseal bone interface. PMID: 15200412
Database Links

KEGG: rno:81512

UniGene: Rn.9900

Protein Families
Chondromodulin-1 family
Subcellular Location
[Chondromodulin-1]: Secreted, extracellular space, extracellular matrix.; [Chondrosurfactant protein]: Endomembrane system; Single-pass membrane protein.
Tissue Specificity
Detected in cartilage, cardiac valves and valvular interstitial cells (at protein level). Expressed in eye.

Q&A

What is Leukocyte Cell-Derived Chemotaxin 1 (Lect1) and its relationship to Chondromodulin-1?

Leukocyte cell-derived chemotaxin 1 (Lect1) is the gene name for what is commonly known as Chondromodulin-1 (ChM-1). It encodes a type II transmembrane glycoprotein that undergoes intracellular cleavage resulting in the secretion of a 25 kDa bioactive molecule. The full-length protein contains 334 amino acids with specific structural features including a furin cleavage site and putative glycosylation sites. The mature protein is predominantly expressed in avascular tissues such as cartilage and cardiac valves, where it exhibits potent antiangiogenic properties capable of inhibiting tumor progression and pathological vascularization .

What are the primary biological functions of Lect1/ChM-1?

Lect1/ChM-1 serves multiple biological functions that make it a subject of significant research interest:

  • Angiogenesis inhibition: ChM-1 prevents blood vessel formation in normally avascular tissues such as cartilage and heart valves .

  • Cartilage development: It plays a critical role in chondrocyte differentiation and cartilage formation during development.

  • Tumor suppression: The antiangiogenic properties of ChM-1 can block tumor progression by preventing neovascularization .

  • Inflammatory modulation: Research suggests ChM-1 participates in inflammatory responses and may be involved in conditions like biliary atresia and liver fibrosis .

The methodological approach to studying these functions often involves recombinant protein administration in relevant tissue culture systems, followed by assessment of angiogenic markers, chondrocyte differentiation, or inflammatory cytokine expression.

What are the optimal storage conditions for recombinant rat Lect1 protein?

For optimal stability and activity retention, recombinant rat Lect1 should be stored according to these guidelines:

  • Store stock solutions at -20°C for routine use, or at -80°C for extended storage to minimize activity loss.

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability.

  • Avoid repeated freeze-thaw cycles, as these significantly degrade protein quality and bioactivity.

  • For ongoing experiments, working aliquots can be maintained at 4°C for up to one week.

  • When preparing aliquots, use sterile, low-protein-binding microcentrifuge tubes and flash-freeze in liquid nitrogen before transferring to long-term storage .

To validate protein quality after storage, researchers should periodically perform activity assays and verify structural integrity through techniques such as circular dichroism or limited proteolysis.

What experimental methods are most effective for detecting Lect1 expression in tissue samples?

Several complementary methods can be employed to detect and quantify Lect1 expression in experimental samples:

  • Real-Time Quantitative PCR (RT-qPCR):

  • Immunohistochemistry (IHC):

    • After antigen retrieval with sodium citrate (pH 6.0), block sections with 5% goat serum.

    • Incubate with anti-LECT2 primary antibody (typically at 1:300 dilution) overnight at 4°C.

    • Use appropriate HRP-conjugated secondary antibodies and DAB for visualization.

    • Counterstain with hematoxylin for nuclear visualization .

  • Enzyme-Linked Immunosorbent Assay (ELISA):

    • Commercial ELISA kits are available specifically for rat Lect1.

    • For serum samples, typically use a 50 μl sample volume per well.

    • Incubate with peroxide-conjugated anti-Lect1 antibody at 37°C for 1 hour.

    • Measure absorbance at 450 nm after reaction with substrate and addition of termination solution .

  • Immunofluorescence:

    • Follow similar tissue preparation as for IHC.

    • Use fluorophore-conjugated secondary antibodies (e.g., Alexa488/594).

    • Include appropriate co-staining markers when investigating interactions with other proteins .

How can researchers effectively validate antibody specificity for rat Lect1?

Validating antibody specificity is critical for accurate Lect1 research. A comprehensive validation approach should include:

  • Western Blot Analysis:

    • Confirm the detection of a single band at approximately 25 kDa (for the secreted form) or 38 kDa (for the full-length protein).

    • Include positive controls (tissues known to express Lect1, such as cartilage) and negative controls (tissues with minimal expression).

    • Perform peptide competition assays where pre-incubation of the antibody with purified Lect1 should abolish the signal.

  • Immunoprecipitation followed by Mass Spectrometry:

    • Immunoprecipitate Lect1 from tissue or cell lysates using the antibody in question.

    • Analyze the precipitated proteins by mass spectrometry to confirm the identity as Lect1.

  • Knockdown/Knockout Validation:

    • Compare staining patterns in wild-type samples versus samples where Lect1 has been knocked down by siRNA or knocked out using CRISPR-Cas9.

    • The signal should be significantly reduced or eliminated in the knockdown/knockout samples.

  • Cross-Reactivity Testing:

    • Test the antibody against human and mouse Lect1 to determine species specificity.

    • This is particularly important given the 89-92% sequence homology between species .

How can Lect1's relationship with TGF-β1 be experimentally investigated?

Recent research has demonstrated that TGF-β1 can upregulate LECT2 expression, suggesting a potential regulatory pathway. To investigate this relationship:

  • Cell Culture Model:

    • Utilize human normal liver cell lines (e.g., L-02) or primary rat hepatocytes.

    • Treat cells with recombinant TGF-β1 (100 ng/ml) for 24 hours.

    • Include control groups (PBS treatment) and inhibitor groups (e.g., ICG001, which inhibits TCF/β-catenin/CBP-mediated transcriptional activity).

    • Measure Lect1 expression using RT-qPCR and Western blot analysis .

  • Signal Transduction Pathway Analysis:

    • Investigate the cAMP-response element-binding protein pathway, as inhibition of this pathway with ICG001 has been shown to reverse TGF-β1-induced Lect1 upregulation.

    • Include phosphorylation state analysis of key signaling proteins in the pathway.

    • Use chromatin immunoprecipitation (ChIP) assays to determine if TGF-β1 induces direct binding of transcription factors to the Lect1 promoter.

  • In Vivo Validation:

    • Develop a rat model with elevated TGF-β1 levels (either through direct administration or disease induction).

    • Analyze liver tissue for Lect1 expression and localization.

    • Correlate Lect1 levels with inflammatory markers and fibrosis severity.

  • Co-localization Studies:

    • Perform immunofluorescence with anti-TGF-β1 and anti-Lect1 antibodies to determine cellular co-localization.

    • Include staining for CD163+ macrophages, which have been implicated as potential sources of TGF-β1 in fibrotic conditions .

What experimental approaches can be used to study Lect1's antiangiogenic properties?

To investigate the antiangiogenic properties of Lect1, researchers can implement these methodological approaches:

  • Endothelial Cell Tube Formation Assay:

    • Culture human umbilical vein endothelial cells (HUVECs) on Matrigel.

    • Add varying concentrations of recombinant rat Lect1 (10-500 ng/ml).

    • Quantify tube formation by measuring total tube length, number of branch points, and loop formation.

    • Include positive controls (VEGF inhibitors) and negative controls.

  • Chorioallantoic Membrane (CAM) Assay:

    • Apply recombinant rat Lect1 to the CAM of developing chicken embryos.

    • Quantify vessel formation and branching over 24-72 hours.

    • Document results through standardized imaging and quantification protocols.

  • In Vivo Matrigel Plug Assay:

    • Prepare Matrigel plugs containing recombinant rat Lect1 and implant subcutaneously in rats.

    • After 7-14 days, harvest plugs and quantify vessel invasion through histological analysis and hemoglobin content measurement.

    • Compare with control plugs containing angiogenic factors like VEGF or bFGF.

  • Tumor Xenograft Models with Lect1 Administration:

    • Establish tumor xenografts in immunocompromised rats.

    • Administer recombinant rat Lect1 systemically or directly into the tumor.

    • Monitor tumor growth and analyze microvascular density through CD31 immunostaining.

    • Correlate findings with tumor hypoxia markers and necrosis.

How can researchers investigate the role of Lect1 in inflammatory conditions such as biliary atresia?

To study Lect1's role in inflammatory conditions, particularly biliary atresia (BA), the following methodological framework can be employed:

  • Patient Sample Analysis:

    • Collect liver biopsy specimens and serum samples from BA patients and appropriate controls.

    • Measure Lect1 expression using RT-qPCR, immunohistochemistry, and ELISA.

    • Correlate Lect1 levels with clinical parameters, fibrosis stages, and inflammatory markers .

  • Cell-Specific Expression Analysis:

    • Perform multi-color immunofluorescence to determine which cell types express Lect1 in BA tissue.

    • Co-stain with markers for hepatocytes, cholangiocytes, stellate cells, and various immune cell populations.

    • Analyze spatial relationships between Lect1-expressing cells and areas of inflammation or fibrosis.

  • Functional Assays:

    • Isolate primary cells from BA and control livers.

    • Treat with recombinant Lect1 and measure inflammatory cytokine production.

    • Assess changes in cell migration, proliferation, and activation state.

  • Animal Models of Biliary Injury:

    • Establish a rat model of biliary obstruction or toxic biliary injury.

    • Monitor Lect1 expression temporal changes during disease progression.

    • Test therapeutic interventions targeting the Lect1 pathway.

    • Create Lect1 knockout models to assess disease susceptibility and progression.

ParameterBiliary Atresia PatientsControl GroupP-value
Serum Lect1 (ng/ml)15.3 ± 4.28.7 ± 2.1<0.001
Liver Lect1 mRNA (fold change)3.8 ± 1.21.0 ± 0.3<0.001
Liver fibrosis score2.8 ± 0.70.5 ± 0.4<0.001
CD163+ macrophages (cells/field)18.5 ± 6.34.2 ± 2.1<0.001

Note: This table presents hypothetical data based on general trends observed in studies of inflammatory markers in biliary atresia. Researchers should generate their own data through the methodologies described.

What are common issues in recombinant Lect1 protein production and how can they be addressed?

Researchers working with recombinant rat Lect1 may encounter several challenges during protein production and purification. Here are methodological solutions to common issues:

  • Low Expression Yields:

    • Optimize codon usage for the expression system (E. coli, insect cells, or mammalian cells).

    • Test different fusion tags (His, GST, MBP) to improve solubility and expression.

    • Adjust induction conditions (temperature, IPTG concentration, induction time).

    • Consider using specialized expression strains designed for disulfide bond formation.

  • Protein Misfolding and Inclusion Body Formation:

    • For E. coli systems, lower the expression temperature to 16-20°C and reduce inducer concentration.

    • Add folding enhancers such as sorbitol or betaine to the culture medium.

    • If inclusion bodies persist, develop an efficient refolding protocol using step-wise dialysis with decreasing concentrations of denaturants.

  • Loss of Biological Activity:

    • Confirm proper disulfide bond formation, which is critical for Lect1 function.

    • Verify glycosylation status when expressing in eukaryotic systems.

    • Include stabilizing agents such as trehalose or sucrose in the storage buffer.

    • Monitor protein quality through circular dichroism or thermal shift assays.

  • Protein Aggregation During Storage:

    • Filter protein solutions through a 0.22 μm filter before storage.

    • Include 5-10% glycerol in the storage buffer to prevent freeze-thaw damage.

    • Consider adding low concentrations of non-ionic detergents (0.01% Tween-20) for very hydrophobic variants.

    • Store in small aliquots to minimize freeze-thaw cycles .

How can researchers distinguish between Lect1/ChM-1 and other related proteins in experimental samples?

Distinguishing Lect1/ChM-1 from related proteins requires careful experimental design and validation:

  • Antibody Selection and Validation:

    • Use antibodies raised against unique epitopes in the Lect1 sequence.

    • Verify specificity through Western blot analysis of tissues known to express Lect1 versus those that do not.

    • Consider using multiple antibodies targeting different regions of the protein.

  • Mass Spectrometry-Based Approaches:

    • Develop a targeted multiple reaction monitoring (MRM) mass spectrometry method.

    • Identify unique peptide sequences that distinguish Lect1 from homologous proteins.

    • Include internal standard peptides for accurate quantification.

  • Expression Pattern Analysis:

    • Leverage tissue-specific expression patterns; Lect1 is predominantly expressed in avascular cartilage and cardiac valves.

    • Compare expression patterns with known related proteins through multi-label immunohistochemistry or in situ hybridization.

  • Functional Assays:

    • Utilize Lect1's distinct antiangiogenic properties in endothelial cell assays.

    • Compare activity profiles with other antiangiogenic factors such as endostatin or thrombospondin.

  • RNA Analysis:

    • Design PCR primers that span unique regions of the Lect1 transcript.

    • Include melt curve analysis in qPCR experiments to confirm amplicon specificity.

    • Consider using RNAscope technology for highly specific in situ hybridization .

What are promising approaches for investigating Lect1's potential therapeutic applications?

Based on Lect1's biological properties, several research avenues could lead to therapeutic applications:

  • Cancer Therapy Development:

    • Design Lect1-derived peptides that retain antiangiogenic activity but have improved pharmacokinetic properties.

    • Develop targeted delivery systems that concentrate Lect1 in tumor microenvironments.

    • Investigate combination therapies with existing chemotherapeutics or immunotherapies.

    • Create conditional expression systems for tumor-specific Lect1 production.

  • Cartilage Regeneration:

    • Engineer scaffolds that provide sustained release of Lect1 for cartilage tissue engineering.

    • Investigate the effects of controlled Lect1 delivery on chondrocyte differentiation and extracellular matrix production.

    • Develop intra-articular injection protocols for osteoarthritis treatment.

    • Study the interaction between Lect1 and other cartilage growth factors.

  • Liver Fibrosis Intervention:

    • Based on the relationship between Lect1 and liver inflammation, develop Lect1 pathway modulators for fibrosis treatment.

    • Investigate the potential of Lect1 as a biomarker for fibrotic progression.

    • Design targeted therapies that modify Lect1 expression in specific liver cell populations .

  • Cardiac Valve Disease Treatment:

    • Explore Lect1's role in preventing pathological vascularization of heart valves.

    • Develop delivery methods for localized Lect1 administration to diseased valves.

    • Investigate Lect1's potential in preventing calcification and maintaining valve integrity .

How can advanced -omics approaches enhance our understanding of Lect1's biological functions?

Integration of multiple -omics technologies can provide comprehensive insights into Lect1's functions:

  • Transcriptomics:

    • Perform RNA-seq on tissues/cells with manipulated Lect1 expression.

    • Identify gene networks regulated by Lect1 under normal and pathological conditions.

    • Use single-cell RNA-seq to characterize cell type-specific responses to Lect1.

  • Proteomics:

    • Conduct pull-down experiments with recombinant Lect1 followed by mass spectrometry to identify binding partners.

    • Use SILAC or TMT labeling to quantify proteome changes in response to Lect1 treatment.

    • Perform phosphoproteomics to identify signaling pathways activated by Lect1.

  • Metabolomics:

    • Profile metabolic changes in tissues/cells exposed to Lect1.

    • Identify metabolic pathways affected by Lect1's activity.

    • Correlate metabolic signatures with angiogenic status and inflammatory responses.

  • Glycomics:

    • Characterize the glycosylation pattern of native Lect1 from different tissues.

    • Investigate how glycosylation affects Lect1's binding properties and bioactivity.

    • Develop glycoengineered variants with enhanced stability or activity.

  • Systems Biology Integration:

    • Develop computational models that integrate multiple -omics datasets.

    • Predict novel functions and interactions of Lect1.

    • Identify potential therapeutic targets within the Lect1 regulatory network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.