Recombinant Rat Leukocyte surface antigen CD47 (Cd47)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Leukocyte Surface Antigen CD47 (Cd47)

Recombinant Rat CD47 is a bioengineered glycoprotein derived from the rat Cd47 gene, expressed in heterologous systems such as HEK293 cells or E. coli. It replicates the extracellular domain of native CD47, a transmembrane protein involved in immune regulation, cell adhesion, and signal transduction. CD47 binds to SIRPα (signal regulatory protein alpha) on macrophages to inhibit phagocytosis, acting as an "eat me/don’t eat me" signal. Recombinant variants are tagged (e.g., His, Fc) for purification and functional studies .

Protein Structure

  • Domain Composition: Contains a single Ig-like V-type domain, critical for SIRPα binding .

  • Post-Translational Modifications: Glycosylation influences binding avidity and solubility. Mammalian-expressed variants (e.g., HEK293) retain native glycosylation, while E. coli-derived proteins lack this modification .

FeatureHis-Tagged CD47 (HEK293)Fc-Tagged CD47 (HEK293)Full-Length CD47 (E. coli)
Molecular Weight~15.2 kDa (predicted)~40.8 kDa (monomer)~34.5 kDa
Apparent Size27–35 kDa (SDS-PAGE)57–62 kDa (dimer)~34.5 kDa
Purity>90%>95%>90%
Binding ActivityBinds mouse SIRPA-Fc (EC₅₀: 0.6–1.4 µg/mL) Binds SIRPα (species-specific) Limited activity (E. coli)

Key Functions

  1. Immune Regulation:

    • Inhibits macrophage phagocytosis via SIRPα engagement, preventing clearance of healthy cells .

    • Modulates dendritic cell maturation and cytokine production .

  2. Cell Adhesion:

    • Acts as a receptor for thrombospondin-1 (THBS1), influencing platelet adhesion and integrin signaling .

  3. Pathological Roles:

    • Tumor cells exploit CD47 to evade immune detection .

    • Upregulated during infections to suppress excessive inflammation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preference in the order notes, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice for shipping, please communicate this preference in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for extended storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please communicate your preference, and we will prioritize development accordingly.
Synonyms
Cd47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-303
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTRE QNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLALTLIVVVGAILFIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLAVVGMCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNN
Uniprot No.

Target Background

Function
CD47 plays a multifaceted role in cell adhesion, immune modulation, and signal transduction. It acts as an adhesion receptor for thrombospondin-1 (THBS1) on platelets, contributing to cell adhesion. It also modulates integrin activity. As a receptor for SIRPA, CD47 binding prevents dendritic cell maturation and inhibits cytokine production in mature dendritic cells. Interaction with SIRPG facilitates cell-cell adhesion, enhances superantigen-dependent T-cell proliferation, and costimulates T-cell activation. CD47 may be involved in membrane transport and/or integrin-dependent signal transduction. It may prevent premature red blood cell elimination and participate in membrane permeability changes following viral infection. Additionally, CD47 plays a significant role in memory formation and synaptic plasticity within the hippocampus.
Gene References Into Functions
  1. Downregulation of CD47 exhibits a protective effect against myocardial ischemia/reperfusion injury, potentially through attenuation of oxidative stress via activation of the eNOS/nitric oxide signaling pathway. PMID: 27960187
  2. CD47 blockade using CD47mAb400, administered to both the donor and recipient, reduced liver graft ischemia reperfusion injury in a rat liver transplantation model. PMID: 25482981
  3. Overexpression of IAP2 in neural stem cells induced neuronal differentiation. PMID: 25706387
  4. The CD47-binding peptide of thrombospondin-1 induces defenestration of liver sinusoidal endothelial cells. PMID: 23799952
  5. Research indicates a novel role for CD47-mediated signaling in regulating the molecular network governing endothelial-dependent T-cell diapedesis. PMID: 23990210
  6. Genetic induction of recipient CD47 expression on xenogeneic donor cells could provide inhibitory signals to recipient macrophages via SIPRalpha. PMID: 23472187
  7. Thrombospondin-1 regulates blood flow through CD47 receptor-mediated activation of NADPH oxidase 1. PMID: 23087362
  8. Data suggest that hyperglycemia induces increased association of IAP with SHPS-1 (tyrosine phosphatase non-receptor type substrate-1), potentially a generalized response of endothelial cells that contributes to endothelial cell dysfunction. PMID: 22193512
  9. IAP plays crucial roles in dendritic outgrowth and synaptic transmission in developing cortical neurons through the activation of MAPK. PMID: 15297459
  10. 4N1K-stimulated mast cell exocytosis involves a CD47/integrin/G(i) protein complex. PMID: 19205621
  11. Amyloid beta peptides trigger CD47-dependent mast cell secretory and phagocytic responses. PMID: 19505377

Show More

Hide All

Database Links

KEGG: rno:29364

STRING: 10116.ENSRNOP00000050938

UniGene: Rn.7409

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in hippocampus.

Q&A

What is the molecular structure and basic function of rat CD47?

Rat CD47 is a membrane protein belonging to the immunoglobulin superfamily. It contains a single extracellular IgV domain, five transmembrane spanning domains, and a short alternatively spliced intracellular cytoplasmic tail . The protein functions primarily in cell adhesion as a receptor for thrombospondin-1 (THBS1) on platelets and plays crucial roles in modulating integrin activity .

Functionally, rat CD47 serves as a receptor for SIRPA, and this interaction prevents maturation of immature dendritic cells while inhibiting cytokine production by mature dendritic cells. Its interaction with SIRPG mediates cell-cell adhesion and enhances superantigen-dependent T-cell proliferation while co-stimulating T-cell activation . Beyond immune regulation, CD47 plays important roles in memory formation and synaptic plasticity in the hippocampus .

How does rat CD47 expression change under different inflammatory conditions?

Unlike many immune-related surface proteins, rat CD47 maintains relatively stable expression levels under inflammatory conditions. Flow cytometry analysis of both primary rat brain microvascular endothelial cells (MVEC) and the rat brain microvascular endothelial cell line GPNT has demonstrated that CD47 is constitutively expressed in rat brain microvasculature and does not change significantly with inflammatory stimulation. Treatment with TNF-α, IFN-γ, or a combination of both cytokines for either 4 or 24 hours does not significantly alter CD47 surface expression levels . This constitutive expression pattern suggests CD47 likely serves as a homeostatic regulator rather than an inflammation-induced mediator.

What is the subcellular localization pattern of CD47 in rat endothelial cells?

Immunofluorescence studies have revealed that rat CD47 displays a distinctive staining pattern in both resting and TNF-α treated endothelium. The protein shows uniform apical expression across the cell surface with notable enrichment at cell-cell junctions . This distribution pattern is consistent with observations in human umbilical vein endothelial cells (HUVEC) and murine lung endothelial cells. Interestingly, flow cytometry and immunofluorescence experiments performed under permeabilizing conditions have shown a lack of significant intracellular pools of CD47, suggesting that the majority of CD47 protein resides at the cell surface rather than in intracellular compartments .

What expression systems are optimal for producing functional recombinant rat CD47?

Multiple expression systems have been successfully employed to produce recombinant rat CD47, each with distinct advantages depending on experimental requirements. The two primary systems documented in the literature are:

  • Human Cell Expression System: Recombinant rat CD47 has been successfully expressed in human cells, particularly when glycosylation patterns are critical. This system produces protein with a DNA sequence encoding rat CD47 (P97829-1) (Met1-Lys140) fused with a polyhistidine tag at the C-terminus . This approach is optimal when studying CD47's interaction with binding partners, as proper glycosylation significantly impacts these interactions.

  • E. coli Expression System: For applications requiring larger quantities or when glycosylation is less critical, E. coli-based expression systems have been utilized. For instance, full-length rat CD47 protein (amino acids 19-303) with an N-terminal His tag has been successfully expressed in E. coli . This system typically offers higher yields but lacks mammalian post-translational modifications.

The choice between these systems should be guided by the specific research application and whether proper folding and post-translational modifications are essential for the planned experiments.

How does glycosylation affect recombinant rat CD47 molecular weight and functionality?

Glycosylation significantly impacts both the apparent molecular weight and functional properties of recombinant rat CD47. While the amino acid sequence of recombinant rat CD47 (Met1-Lys140) predicts a molecular mass of approximately 15.2 kDa, SDS-PAGE analysis under reducing conditions reveals an apparent molecular mass of 27-35 kDa . This substantial difference is attributed to glycosylation, which adds significantly to the protein's mass and creates a characteristic smear pattern on gels.

Functionally, glycosylation is critical for CD47's proper binding to its ligands. Functional ELISA assays demonstrate that properly glycosylated recombinant rat CD47-His can effectively bind mouse SIRPA-Fc, confirming that the glycosylation pattern enables proper protein-protein interactions . This suggests that for applications studying CD47-SIRP interactions, properly glycosylated recombinant protein produced in mammalian expression systems may be essential for obtaining physiologically relevant results.

What are the optimal storage conditions for maintaining recombinant rat CD47 stability?

Proper storage is critical for maintaining the stability and activity of recombinant rat CD47. Based on manufacturer recommendations, the following storage guidelines should be followed:

  • Long-term storage: Lyophilized protein should be stored at -20°C or lower for extended periods .

  • Working aliquots: Upon reconstitution, working aliquots should be stored at -20°C or -70°C .

  • Avoid freeze-thaw cycles: Repeated freezing and thawing significantly degrades protein quality and should be avoided. It's recommended to prepare smaller working aliquots to minimize the number of freeze-thaw cycles .

  • Buffer considerations: When stored, recombinant rat CD47 is typically maintained in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability .

For short-term use (up to one week), working aliquots can be stored at 4°C, but prolonged storage at this temperature is not recommended .

What are the established protocols for CD47 crosslinking experiments in endothelial cell studies?

CD47 crosslinking experiments are valuable for studying downstream signaling events and have been standardized in several studies. A validated protocol for CD47 crosslinking in endothelial cells includes:

  • Cell preparation: Confluent serum-starved, TNF-α stimulated endothelial cells (such as GPNT cells) are used as the experimental model.

  • Primary antibody application: Anti-CD47 monoclonal antibody (10 μg/ml) is applied to the cells and incubated for 30 minutes.

  • Secondary crosslinking: Following primary antibody incubation, goat anti-mouse antibody (GAM, 10 μg/ml) is added for the desired time period to induce crosslinking .

For inhibitor studies, cells can be pre-treated with various pathway inhibitors before CD47 crosslinking:

  • Pertussis Toxin (PTX): 200 ng/ml, 2h at 37°C, followed by washing and re-equilibration

  • C3 transferase: 3.75 μg/ml, 2h at 37°C

  • PP2 (Src inhibitor): 10 μM, 30 min at 37°C

  • LY294002 (PI3K inhibitor): 10 μM, 30 min at 37°C

With the exception of PTX, inhibitors should be maintained in the medium during antibody crosslinking of CD47 to ensure continuous pathway blockade.

How can recombinant rat CD47 be used in transmigration assays to study leukocyte diapedesis?

Transmigration assays using recombinant rat CD47 are valuable tools for investigating leukocyte diapedesis across the vascular endothelium. A methodological approach includes:

  • Endothelial monolayer preparation: Culture rat brain microvascular endothelial cells (either primary MVEC or GPNT cell line) to confluence on transwell inserts coated with appropriate extracellular matrix proteins.

  • Pre-treatment options:

    • For blocking studies: Pretreat the endothelial monolayer with blocking antibodies against CD47 (such as OX101 mAb) to assess CD47's role in transmigration.

    • For pathway inhibition: Apply specific signaling pathway inhibitors (Src, PI3K, etc.) to determine mechanism.

  • Leukocyte preparation: Isolate T cells and label them with appropriate fluorescent markers for tracking.

  • Transmigration assessment: Add labeled T cells to the upper chamber and measure migration to the lower chamber over time using flow cytometry or fluorescent microscopy.

  • Analysis parameters: Quantify the percentage of transmigrated cells and the kinetics of migration. Additionally, assess the formation of transmigratory cups and podoprints enriched in CD47 on the endothelial surface using live cell microscopy techniques .

This methodology has revealed that CD47 blockade results in decreased T cell transmigration across microvascular endothelium, similar to the effects observed with ICAM1 blockade, suggesting CD47's involvement at specific steps in the diapedesis process .

What functional ELISA protocols can assess the binding capacity of recombinant rat CD47?

Functional ELISA assays provide quantitative assessment of recombinant rat CD47's binding capacity to its ligands. A validated protocol includes:

  • Plate preparation: Immobilize recombinant rat CD47-His at 10 μg/ml (100 μl per well) on a high-binding ELISA plate overnight at 4°C.

  • Blocking: Block non-specific binding sites with an appropriate buffer (typically PBS containing 1-3% BSA) for 1-2 hours at room temperature.

  • Ligand application: Add various concentrations of the binding partner (such as mouse SIRPA-Fc) to the wells and incubate for 1-2 hours at room temperature.

  • Detection: Use an appropriate detection system (typically HRP-conjugated secondary antibody against the Fc portion of the ligand) followed by substrate addition.

  • Analysis: Measure the EC50 value to quantify binding affinity between rat CD47 and its ligand .

This approach allows researchers to not only confirm the functionality of recombinant rat CD47 but also to quantitatively compare different protein preparations or assess the impact of various mutations on binding capacity.

What signaling pathways are activated upon CD47 engagement in rat endothelial cells?

CD47 engagement in rat endothelial cells triggers several important signaling cascades that collectively regulate vascular permeability and leukocyte transmigration:

  • Calcium Mobilization: CD47 crosslinking results in intracellular calcium mobilization, which serves as an early signaling event following receptor engagement .

  • Src Kinase Activation: Upon CD47 engagement, there is activation of src family kinases, which can be blocked using the specific inhibitor PP2 (10 μM) .

  • AKT1/PI3K Pathway: CD47 crosslinking activates the AKT1/PI3K pathway, which can be inhibited using LY294002 (10 μM) .

  • Cytoskeletal Remodeling: These signaling pathways converge to induce cytoskeletal remodeling, which is essential for altering endothelial cell shape during leukocyte transmigration .

  • VEC Phosphorylation: Vascular Endothelial Cadherin (VEC) undergoes phosphorylation following CD47 engagement, which is a necessary step for regulating endothelial barrier function during T cell transmigration .

These signaling events are integral to CD47's role in facilitating leukocyte diapedesis across the vascular endothelium, highlighting its importance in immune cell trafficking during inflammation and immune surveillance.

How does the species-specific interaction between CD47 and SIRPα impact xenotransplantation research using rat models?

The CD47-SIRP alpha interaction demonstrates strict species specificity, which has significant implications for xenotransplantation research using rat models. This species barrier occurs because CD47 from one species often fails to properly engage with SIRPα from another species .

In xenotransplantation scenarios involving rat tissues, the inability of rat CD47 to effectively engage with human SIRPα leads to failure of the "don't eat me" signal that normally prevents phagocytosis of healthy cells. Consequently, when rat cells or tissues are transplanted into human recipients (or humanized models), the lack of this inhibitory signal results in rapid clearance by host macrophages, contributing significantly to xenograft rejection .

This species specificity must be considered when designing xenotransplantation experiments using rat models or when interpreting results from such studies. Strategies to overcome this barrier might include:

  • Engineering recombinant rat CD47 with modifications that enable cross-species SIRPα binding

  • Using genetic approaches to express human CD47 in rat tissues intended for xenotransplantation

  • Developing SIRPα blocking antibodies that can prevent phagocytic clearance regardless of CD47 compatibility

Understanding these species-specific interactions is crucial for advancing xenotransplantation research using rat models and developing strategies to overcome rejection mechanisms.

What is the relationship between CD47 and integrin signaling in rat cellular systems?

CD47 maintains complex relationships with multiple integrin molecules in rat cellular systems, serving as both a regulator and a signaling partner. The specific interactions include:

  • Physical Association: CD47 physically associates in cis with multiple integrins, including alpha 4 beta 1, alpha V beta 3, alpha 2b beta 3, and alpha 2 beta 1 on the cell surface .

  • Bidirectional Modulation: These associations can either positively or negatively modulate integrin-mediated functions, depending on the specific integrin involved and the cellular context .

  • Signal Transduction: CD47 may play a role in integrin-dependent signal transduction pathways, though the exact mechanisms in rat cells require further characterization .

  • Membrane Microdomain Organization: Evidence suggests CD47 helps organize membrane microdomains that facilitate integrin clustering and activation, particularly in the context of cell adhesion and migration.

  • Adhesion Receptor Function: Beyond its signaling roles, CD47 functions directly as an adhesion receptor for thrombospondin-1 (THBS1) on platelets while simultaneously influencing integrin activity .

This complex interplay between CD47 and various integrins underlies its importance in processes like cell adhesion, migration, and phagocytosis, making it a critical factor in both physiological and pathological contexts in rat model systems.

How can researchers address potential contamination issues when working with recombinant rat CD47?

When working with recombinant rat CD47, contamination issues can significantly impact experimental results. A systematic approach to address these concerns includes:

  • Endotoxin testing: Recombinant proteins produced in bacterial systems should be tested for endotoxin levels, which should be maintained below 1.0 EU per μg as determined by the LAL method . High endotoxin levels can trigger inflammatory responses that confound interpretation of CD47-specific effects.

  • Purity assessment: Verify protein purity using SDS-PAGE, which should demonstrate >90% purity . Multiple bands or smears unrelated to glycosylation may indicate contamination with host cell proteins.

  • Functional validation: Perform binding assays (such as the functional ELISA described earlier) to confirm that the recombinant protein retains its ability to interact with known ligands like SIRPA .

  • Sterility measures: Implement aseptic technique when handling reconstituted protein and consider filter sterilization (0.22 μm) for critical applications.

  • Aggregation monitoring: Check for protein aggregation using dynamic light scattering or size-exclusion chromatography, as aggregated protein can give false results in many assays.

If contamination is suspected, performing parallel experiments with alternative lots or sources of recombinant rat CD47 can help distinguish CD47-specific effects from artifacts caused by contaminants.

What are the critical considerations when interpreting CD47 knockout or blockade experiments in rat models?

When interpreting CD47 knockout or blockade experiments in rat models, several critical considerations should be taken into account:

  • Compensatory mechanisms: Long-term CD47 deficiency may trigger upregulation of alternative pathways that compensate for CD47 function, potentially masking the full phenotypic impact of CD47 loss.

  • Context-dependent effects: CD47's functions vary significantly across different tissues and cellular contexts. Effects observed in one organ system (e.g., brain microvasculature) may not translate to others (e.g., lung or kidney).

  • Antibody specificity: When using CD47-blocking antibodies (such as OX101 mAb), confirm specificity to avoid off-target effects that could confound interpretation .

  • Timing considerations: The timing of CD47 blockade relative to inflammatory stimuli is critical, as CD47's role may differ during initiation versus resolution phases of inflammation.

  • Integrin crosstalk: Given CD47's associations with various integrins, effects attributed to CD47 blockade might partially result from altered integrin signaling .

  • Species-specific interactions: Remember that CD47-SIRPα interactions are species-specific, which may impact the translation of findings between rat models and human applications .

How can the discrepancy between predicted and observed molecular weights of recombinant rat CD47 be explained in experimental data?

The significant discrepancy between predicted and observed molecular weights of recombinant rat CD47 is a common source of confusion in experimental data interpretation. Several factors explain this phenomenon:

  • Glycosylation impact: The primary contributor to this discrepancy is glycosylation. While the amino acid sequence of recombinant rat CD47 (Met1-Lys140) predicts a molecular mass of 15.2 kDa, SDS-PAGE analysis consistently shows an apparent molecular mass of 27-35 kDa due to extensive glycosylation .

  • Expression system variations: The extent of glycosylation varies between expression systems. Proteins expressed in mammalian cells (like human cells) typically show more extensive and complex glycosylation patterns than those expressed in bacterial systems .

  • Glycoform heterogeneity: The observed "smear" rather than a sharp band on SDS-PAGE results from heterogeneous glycosylation, with individual protein molecules carrying slightly different glycan structures.

  • Impact of reducing conditions: Under reducing conditions in SDS-PAGE, the disruption of disulfide bonds may expose additional glycosylation sites, further affecting migration patterns.

  • Tag contribution: The presence of tags (such as His tags) also contributes to the observed molecular weight, though to a much lesser extent than glycosylation.

To accurately interpret experimental data, researchers should always run appropriate controls and be aware that the apparent molecular weight of recombinant rat CD47 on SDS-PAGE will not match the weight calculated from the amino acid sequence alone.

How can recombinant rat CD47 be utilized in developing targeted immunotherapies for neuroinflammatory conditions?

Recombinant rat CD47 offers valuable opportunities for developing targeted immunotherapies for neuroinflammatory conditions, with several strategic approaches:

  • Modulating T cell transmigration: Since CD47 plays a critical role in T cell transmigration across the brain microvasculature , targeting this pathway could help control neuroinflammation in conditions like multiple sclerosis or encephalitis. Recombinant rat CD47 can be used to develop and screen potential therapeutic agents that modulate this process.

  • Blocking specific signaling pathways: Research has identified that CD47 engagement activates specific signaling cascades including src kinase and AKT1/PI3K pathways in brain microvascular endothelial cells . Using recombinant rat CD47 in high-throughput screening systems can help identify compounds that selectively inhibit these inflammatory pathways.

  • Targeting the CD47-SIRP interaction: The interaction between CD47 and SIRP proteins is crucial for immune regulation. Recombinant rat CD47 can be used to develop bispecific antibodies or fusion proteins that modulate this interaction specifically in neuroinflammatory contexts.

  • Engineering blood-brain barrier (BBB) models: Incorporating recombinant rat CD47 into in vitro BBB models allows for the study of leukocyte transmigration mechanisms and the testing of potential therapeutics under controlled conditions that better mimic the in vivo environment.

This research direction is particularly significant given CD47's demonstrated role in memory formation and synaptic plasticity in the hippocampus , suggesting that carefully targeted therapies could potentially address both inflammatory and neurodegenerative aspects of neurological disorders.

What methodological approaches can distinguish between CD47's roles in phagocytosis inhibition versus leukocyte transmigration?

Distinguishing between CD47's distinct roles in phagocytosis inhibition and leukocyte transmigration requires sophisticated methodological approaches:

  • Domain-specific mutant analysis: Creating recombinant rat CD47 with specific domain mutations can help isolate functions. For example:

    • Mutations in the SIRP-binding domain would primarily affect phagocytosis inhibition

    • Modifications to regions involved in integrin association would more specifically impact transmigration functions

  • Pathway-selective inhibition: Using the established signaling pathways activated upon CD47 engagement , researchers can selectively inhibit:

    • Src kinase (using PP2, 10 μM)

    • PI3K (using LY294002, 10 μM)

    • Calcium signaling pathways
      This allows determination of which pathways are critical for each function.

  • Temporal separation experiments: Since phagocytosis inhibition and transmigration likely occur with different kinetics, time-course experiments using live-cell imaging can separate these functions temporally.

  • Cell-specific approaches: Using cell types that predominantly display one function over the other:

    • Microglia studies to focus on phagocytosis

    • Brain microvascular endothelial cells to emphasize transmigration

  • Combined in vitro systems: Developing complex co-culture systems that allow simultaneous measurement of both phagocytosis and transmigration within the same experimental setup, enabling direct comparison of how specific interventions affect each process.

These methodological approaches not only help distinguish between CD47's diverse functions but also provide insights into how these functions might be selectively targeted for therapeutic purposes.

What are the experimental considerations when studying CD47's role in memory formation and synaptic plasticity in rat hippocampal models?

Investigating CD47's role in memory formation and synaptic plasticity in rat hippocampal models requires careful experimental design:

  • Model system selection: Consider the appropriate experimental model:

    • Acute hippocampal slices preserve local circuitry while allowing controlled manipulation

    • Primary hippocampal neuron cultures offer simplified systems for molecular studies

    • In vivo models provide behavioral context but with greater complexity

  • Expression pattern characterization: Before functional studies, thoroughly characterize CD47 expression patterns across hippocampal subregions (CA1, CA3, dentate gyrus) and synaptic compartments using immunohistochemistry and subcellular fractionation .

  • Functional readouts: Employ multiple complementary approaches to assess synaptic function:

    • Electrophysiological recordings (field potentials, patch-clamp) to measure synaptic transmission and plasticity

    • Live imaging of synaptic markers to track structural changes

    • Biochemical assays to assess synaptic protein expression and modification

  • Specificity controls: Implement rigorous controls to ensure specificity:

    • Use multiple independent CD47 blocking approaches (antibodies, genetic knockdown)

    • Include rescue experiments with recombinant rat CD47 following knockdown

    • Control for potential developmental effects by using inducible systems

  • Behavioral correlates: Connect molecular and cellular findings to behavior using:

    • Spatial memory tasks (Morris water maze, Barnes maze)

    • Fear conditioning paradigms

    • Novel object recognition tests

  • Temporal considerations: Account for CD47's potentially different roles during:

    • Development versus adult plasticity

    • Learning acquisition versus consolidation versus recall

    • Short-term versus long-term plasticity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.