Recombinant Rat Leukotriene-B (4) omega-hydroxylase 2 (Cyp4f3)

Shipped with Ice Packs
In Stock

Description

Catalytic Activity

Cyp4f3 omega-hydroxylates LTB₄ at the ω-1 or ω-2 position, producing 19-hydroxy-LTB₄ or 18-hydroxy-LTB₄, respectively. Key kinetic parameters from rat homologs (Cyp4f5/Cyp4f6) include:

  • Substrate Specificity:

    • LTB₄: Kₘ = 9.7–26 μM (rat Cyp4f5/Cyp4f6) .

    • 8-HETE: Kₘ = 18.6 μM, Vₘₐₓ = 15.8 nmol/min/nmol P450 (rat Cyp4f1) .

  • Inhibitors: Arachidonic acid (competitive inhibition) and prostaglandin A₁ .

Table 2: Catalytic Parameters of Rat CYP4F Enzymes

EnzymeSubstrateKₘ (μM)Vₘₐₓ (nmol/min/nmol)Source
Cyp4f5LTB₄9.715.8
Cyp4f6LTB₄266.5
Cyp4f18-HETE18.615.8

Role in Inflammation

  • Cyp4f3 regulates inflammation by degrading LTB₄, a potent chemoattractant in neutrophil-mediated responses .

  • Knockdown studies in rat hepatocytes show elevated LTB₄ levels correlate with exacerbated inflammation .

Regulatory Mechanisms

  • Cytokine Influence: Pro-inflammatory cytokines (IL-1β, IL-6, TNF-α) upregulate Cyp4f expression, while IL-10 suppresses it .

  • Transcriptional Control: Promoter regions contain binding sites for GATA, C/EBP, and MZF-1 transcription factors .

Disease Associations

  • Cancer: Overexpression of CYP4F3 homologs in humans is linked to chemotherapy resistance (e.g., oxaliplatin in colorectal cancer) .

  • Mutation Effects: A missense mutation (p.L375V) in human CYP4F3 reduces LTB₄ metabolism by >90%, highlighting catalytic domain importance .

Production and Purification

Recombinant rat Cyp4f3 is typically produced via:

  • Expression System: E. coli with N-terminal His-tag for affinity chromatography .

  • Purification Steps:

    1. Solubilization with detergents.

    2. Sequential chromatography (Ni²⁺-NTA, DEAE, hydroxylapatite).

    3. HPLC refinement for homogeneity .

Table 3: Production Specifications

ParameterDetailSource
Purity>90% (SDS-PAGE)
Storage-80°C in Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water + glycerol

Applications in Research

  • Drug Development: Used to screen inhibitors of LTB₄ synthesis (e.g., zileuton) for anti-inflammatory therapies .

  • Mechanistic Studies: Elucidates omega-hydroxylation pathways in eicosanoid metabolism .

  • Structural Biology: Serves as a template for modeling human CYP4F3 mutations .

Challenges and Future Directions

  • Species-Specific Variants: Functional differences between rat Cyp4f5/Cyp4f6 and human CYP4F3A/B complicate translational research .

  • Therapeutic Targeting: Small-molecule modulators of Cyp4f3 could optimize LTB₄ levels in chronic inflammation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Cyp4f3; Cyp4f18; Cytochrome P450 4F3; CYPIVF3; Leukotriene-B(4 omega-1/omega-2 hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cyp4f3
Target Protein Sequence
MPLLSLSWLGLGHTAASPWLLLLLVGASCLLAYILPQVYAVFENSRRLRRFPQPPPRNWL FGHLGLIQSSEEGLLYIQSLSRTFRDVCCWWVGPWHPVIRIFHPAFIKPVILAPASVAPK DRVFYRFLRPWLGDGLLLSTGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQR LASQGSARLDMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILELSALVARRHQSLL LHVDLFYHLTRDGMRFRKACRLVHDFTDAVIRERRCTLPDQGGDDALKAKAKAKTLDFID VLLLSKDEHGEALSDEDIRAEADTFMFGGHDTTASGLSWILYNLAKHPEYQERCRQEVRE LLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPATAISRCCTQDIMLPDGRVIPKGVIC RISIFGTHHNPAVWPDPEVYNPFRFDADNGKGRSPLAFIPFSAGPRNCIGQTFAMSEMKV ALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLRVEPLSAGAH
Uniprot No.

Target Background

Function

Recombinant Rat Leukotriene-B4 omega-hydroxylase 2 (CYP4F3) is a cytochrome P450 monooxygenase that metabolizes the pro-inflammatory lipid mediator leukotriene B4 (LTB4). It hydroxylates LTB4 at the ω-1 and ω-2 positions, inactivating it and contributing to the resolution of inflammation. This process involves molecular oxygen, where one oxygen atom is inserted into the substrate and the other is reduced to water, with two electrons provided by NADPH via cytochrome P450 reductase (CPR).

Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.

Q&A

How do rat Cyp4f enzymes compare structurally and functionally within the family?

In rats, the Cyp4f family includes several members with varying substrate specificities and tissue distributions. Particularly relevant are Cyp4f5 and Cyp4f6, which convert LTB4 to form hydroxy-LTB4 derivatives. Specifically, Cyp4f6 converts LTB4 to form 19- and 18-hydroxy-LTB4 with an apparent Km of 26 μM, while Cyp4f5 converts LTB4 predominantly to 18-hydroxy-LTB4 with an apparent Km of 9.7 μM . These enzymes show differential expression patterns: they are active in the lung and to some extent in the brain, kidney, and testis, suggesting tissue-specific roles in inflammatory regulation . The rat Cyp4f enzymes share structural homology with other CYP4 family members, characterized by their ability to perform omega-hydroxylation of fatty acids and eicosanoids.

What are the key differences between rat Cyp4f3 and human CYP4F3?

Human CYP4F3 exists in two splice variants: CYP4F3A and CYP4F3B, with distinct tissue distribution and substrate preferences. CYP4F3A is expressed predominantly in neutrophils and has high affinity for LTB4, while CYP4F3B is mainly expressed in liver and kidney and shows greater activity toward arachidonic acid and omega-3 polyunsaturated fatty acids . In comparison, rat Cyp4f orthologs show some functional similarities but with different kinetic parameters. For instance, in mouse myeloid cells, Cyp4f18 (the functional ortholog of human CYP4F3A) catalyzes the conversion of LTB4 to 19-OH-LTB4 . These species-specific differences must be considered when using rat models to study processes relevant to human inflammation.

What are the optimal conditions for expressing functional recombinant rat Cyp4f3?

For optimal expression of functional recombinant rat Cyp4f3, researchers should consider several critical factors. First, selection of an appropriate expression system is crucial—bacterial systems (E. coli) offer high yield but may lack proper post-translational modifications, while mammalian cell lines (such as Chinese Hamster Ovary cells) provide better processing but lower yield. For rat Cyp enzymes, microsomes derived from rat tissues serve as excellent positive controls for activity assays .

When using heterologous expression systems, co-expression with NADPH-cytochrome P450 reductase is essential for functional activity. Optimal conditions typically include:

  • Temperature: 27-30°C for expression phases

  • Induction: IPTG concentrations of 0.5-1.0 mM for bacterial systems

  • Harvesting time: 48-72 hours post-transfection for mammalian systems

  • Buffer composition: Typically 100 mM potassium phosphate (pH 7.4) containing 20% glycerol and 0.1 mM EDTA for enzyme stability

For quality control, verify protein expression via Western blotting and assess enzymatic activity through LTB4 hydroxylation assays.

What assays are recommended for measuring rat Cyp4f3 enzymatic activity?

Several methodological approaches can be employed to measure rat Cyp4f3 enzymatic activity:

HPLC-Based Assays:

  • Incubate recombinant Cyp4f3 with LTB4 in the presence of NADPH

  • Extract metabolites using organic solvents

  • Analyze using reverse-phase HPLC with UV detection at 270-280 nm

  • Quantify hydroxy-LTB4 metabolites (18-OH-LTB4, 19-OH-LTB4, and 20-OH-LTB4)

LC-MS/MS Methods:

  • Provides higher sensitivity and specificity for metabolite identification

  • Enables simultaneous quantification of multiple hydroxylated products

  • Can detect metabolites at nanomolar concentrations

Fluorescence-Based Assays:

  • Using fluorescent substrates that mimic LTB4 structure

  • Provides real-time monitoring of enzymatic activity

  • Suitable for high-throughput screening applications

For kinetic studies, researchers should determine both Km and Vmax by varying substrate concentrations. The apparent Km values for LTB4 with rat Cyp4f enzymes typically range from 9.7 μM (for Cyp4f5) to 26 μM (for Cyp4f6) , which can serve as reference points for Cyp4f3 characterization.

How can strain differences impact Cyp4f3 expression and activity studies?

Significant strain differences exist in cytochrome P450 expression and activity between commonly used laboratory rat strains. When working with recombinant rat Cyp4f3, researchers should consider these strain variations:

ParameterWistar RatsSprague-Dawley Rats
CYP1A ActivityHigher in liverHigher in intestine
CYP2B1 ActivityLower in liverHigher in liver
CYP3A2 ActivityHigher in liverHigher in liver
Tissue DistributionQualitatively similar to SDQualitatively similar to Wistar

While the table above presents data for other CYP enzymes , similar strain differences likely exist for Cyp4f enzymes. These variations should be considered when:

  • Selecting source tissue for recombinant protein production

  • Designing experiments with recombinant Cyp4f3

  • Interpreting results across different studies using rats from different strains

  • Validating recombinant enzyme properties against native enzyme sources

When possible, researchers should verify the strain source of their recombinant protein and match experimental conditions accordingly.

How does Cyp4f3-mediated LTB4 metabolism influence inflammatory processes?

Cyp4f3-mediated metabolism of LTB4 plays a crucial regulatory role in inflammatory processes through several mechanisms:

  • Regulation of LTB4 bioavailability: By catalyzing the omega-hydroxylation of LTB4, Cyp4f3 reduces the concentration of this potent chemoattractant and proinflammatory mediator. LTB4 is a key mediator in inflammation, functioning as a potent neutrophil chemotactic agent .

  • Formation of bioactive metabolites: The primary product, 20-OH-LTB4, can retain significant biological activity. Some studies indicate that 20-OH-LTB4 may exhibit similar functional activity to LTB4 and similar binding characteristics with human polymorphonuclear leukocytes (PMNLs) . This suggests that the hydroxylated metabolite may function as an important inflammatory factor in its own right.

  • Impact on neutrophil function: Inhibition of Cyp4f18 (the mouse ortholog of human CYP4F3A) led to a 220% increase in polymorphonuclear leukocyte chemotaxis to LTB4 in mice , demonstrating the importance of this enzymatic pathway in regulating neutrophil recruitment during inflammation.

  • Modulation of inflammatory resolution: In rodent models of lipopolysaccharide-induced inflammatory infection and injury, the decreased expression of Cyp4f enzymes in the liver correlates with increased concentrations of leukotrienes and prostaglandins. Conversely, upregulation of Cyp4f enzymes leads to decreased levels of these inflammatory mediators, thus alleviating inflammation .

What is the potential of Cyp4f3 as a therapeutic target in inflammatory conditions?

Cyp4f3 represents a promising therapeutic target for inflammatory conditions based on several lines of evidence:

  • Traumatic brain injury model: In a rat model of traumatic brain injury, reducing LTB4 levels via activation of Cyp4f-mediated LTB4 decomposition helped alleviate post-traumatic pulmonary inflammation . This suggests that enhancing Cyp4f3 activity could be a strategy for reducing inflammation in acute injury settings.

  • Biomarker potential: Recent studies have shown that 20-OH-LTB4 might function as a potential biomarker for the diagnosis and risk assessment of intracerebral hemorrhage stroke (ICH), distinguishing patients with ICH from healthy individuals and patients with acute ischemic stroke . This finding provides new strategies for diagnosis, prevention, and treatment of ICH.

  • Purulent peritonitis: Analysis of peritoneal metabolites in patients with purulent peritonitis or non-performatives appendicitis revealed that 20-OH-LTB4 might be involved in the pathophysiological mechanisms of suppurative inflammation , suggesting Cyp4f3 activity modulation could affect disease progression.

  • Dual receptor system: The discovery of a second leukotriene B4 receptor (BLT2) that binds LTB4 with different affinity than the original receptor (BLT1) provides another dimension to therapeutic targeting . Since BLT2 is expressed ubiquitously while BLT1 is predominantly expressed in leukocytes, modulating Cyp4f3 activity could differentially affect signaling through these two receptor systems.

  • Anti-inflammatory therapy: BLT2 has been identified as a novel target for anti-inflammatory therapy , and by extension, enzymes like Cyp4f3 that regulate BLT2 ligand availability could serve as indirect modulators of this signaling pathway.

How can CRISPR/Cas9 technology be applied to study rat Cyp4f3 function?

CRISPR/Cas9 technology offers powerful approaches for investigating rat Cyp4f3 function through precise genetic manipulation:

  • Knockout models: Similar to the CYP3A1/2 knockout rat model mentioned in the search results , CRISPR/Cas9 can be used to generate Cyp4f3 knockout rats. This approach allows researchers to assess the physiological and pathological consequences of complete Cyp4f3 deficiency. Key considerations include:

    • Design of guide RNAs targeting conserved exons of the Cyp4f3 gene

    • Verification of knockout efficiency through genomic sequencing, RT-PCR, and Western blotting

    • Comprehensive phenotyping focusing on inflammatory parameters and LTB4 metabolism

  • Knockin models: CRISPR/Cas9 can be used to introduce specific mutations or human CYP4F3 variants into the rat genome to create humanized models. This is particularly valuable for:

    • Studying human CYP4F3 polymorphisms in an in vivo context

    • Testing human-specific inhibitors or activators

    • Investigating species differences in drug metabolism and toxicity

  • Tissue-specific manipulation: Combining CRISPR with tissue-specific promoters allows for targeted manipulation of Cyp4f3 in specific cell types such as:

    • Neutrophils to study inflammatory cell recruitment

    • Hepatocytes to investigate systemic LTB4 metabolism

    • Renal epithelial cells to examine effects on kidney function

  • Reporter systems: CRISPR can be used to tag Cyp4f3 with fluorescent proteins or other reporters to:

    • Monitor expression patterns during inflammation

    • Track protein localization and trafficking

    • Assess real-time regulation in response to inflammatory stimuli

What are the signaling pathways that regulate Cyp4f3 expression and activity?

Multiple signaling pathways regulate the expression and activity of Cyp4f3, with important implications for inflammatory homeostasis:

  • Cytokine-mediated regulation: Proinflammatory cytokines, including IL-1β, IL-6, and TNF-α, induce CYP4F expression through STAT3 signaling pathways . Conversely, the anti-inflammatory cytokine IL-10 inhibits CYP4F expression . This cytokine-mediated regulation creates a complex feedback system where the inflammatory state of the tissue modulates Cyp4f3 expression.

  • NF-κB pathway: CYP ω-hydroxylase-mediated eicosanoids, particularly 20-HETE, can stimulate NF-κB activation . This creates another regulatory loop, as NF-κB is a master regulator of inflammatory gene expression.

  • MAPK/ERK pathways: 20-HETE can stimulate MAPK/ERK pathways, increasing the protein expression levels of IL-8 and adhesion molecule ICAM, leading to endothelial cell activation . This suggests that metabolites produced by Cyp4f3 may themselves regulate enzyme expression through these signaling cascades.

  • PPAR signaling: ω-hydroxylated products generated by CYP enzymes can function as endogenous PPARα ligands . Since PPARα is involved in the regulation of inflammatory responses, this represents another mechanism by which Cyp4f3 activity may indirectly regulate its own expression.

  • Oxidative stress pathways: In the spontaneously hypertensive rat model, inhibition of 20-HETE formation by CYP ω-hydroxylase inhibitors significantly reduced oxidative stress , suggesting a connection between oxidative stress pathways and Cyp4f3 regulation.

How does Cyp4f3 interact with other enzymes involved in eicosanoid metabolism?

Cyp4f3 functions within a complex network of enzymes involved in eicosanoid metabolism, with significant cross-talk between pathways:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.