Recombinant Rat Leukotriene B4 receptor 2 (Ltb4r2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ltb4r2; Leukotriene B4 receptor 2; LTB4-R 2; LTB4-R2; LTB4 receptor JULF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSVCYRPPGNETLLSWKGSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPTAGRPLAATL VLHLALADGAVLLLTPLFVAFLSRQAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRC LAVTRPFLAPRLRSPALARRLLLGVWLAALVLAVPAAVYRHLWGDRVCQLCHPSAVHAAA HLSLETLTAFVLPFGTVLGCYGVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPY HAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG PRFLTRLFEGSGEARVGSRSREGTMELRTTPRLKVVGQGRGYGDPGGGGRMEKDSQEW
Uniprot No.

Target Background

Function
Leukotriene B4 receptor 2 (Ltb4r2) is a low-affinity receptor for leukotrienes, including leukotriene B4. It mediates chemotaxis of granulocytes and macrophages. The response is triggered through G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is rat Leukotriene B4 receptor 2 (Ltb4r2) and how does it differ from Ltb4r1?

Ltb4r2 is a G protein-coupled receptor that binds leukotriene B4 (LTB4) and other oxylipins. While both Ltb4r1 (BLT1) and Ltb4r2 (BLT2) bind LTB4, they show distinct expression patterns and functions. Ltb4r1 is predominantly expressed on immune cells including neutrophils, macrophages, and effector T cells, mediating chemotaxis and activation . In contrast, Ltb4r2 has broader ligand specificity, binding not only LTB4 but also other lipid mediators like 12-hydroxyheptadecatrienoic acid (12-HHTrE) . Both receptors show homology with other chemoattractant receptors including FMLP, C5a, and IL-8 receptors (approximately 30%), but do not show extensive homology with prostanoid receptors .

What is the molecular structure of rat Ltb4r2 and how homologous is it to other species?

Rat Leukotriene B4 receptor consists of 351 amino acids and shares significant sequence homology with LTB4 receptors from other species. Specifically, rat BLT shows homologies of 80.2% to human BLT, 93.2% to mouse BLT, and 71.6% to guinea pig BLT . When expressed in human embryonic kidney (HEK)-293 cells, rat BLT demonstrates specific and high-affinity binding to LTB4 with a Kd value of 0.68 nM . This high degree of conservation across species suggests the fundamental importance of this receptor in biological processes.

In which tissues and cell types is rat Ltb4r2 primarily expressed?

Northern blot analysis has shown that BLT is exclusively expressed in polymorphonuclear leukocytes . Furthermore, the expression of BLT is high in proteosepeptone-activated peritoneal macrophages, while resident macrophages do not show significant expression . This expression pattern indicates that Ltb4r2 is upregulated during immune cell activation, suggesting important roles in inflammatory responses. In addition to immune cells, studies have detected Ltb4r2 expression in the brain, particularly in regions involved in blood pressure regulation, where it may participate in neuro-immune signaling pathways .

What are the recommended methods for producing and purifying recombinant rat Ltb4r2?

Producing functional recombinant rat Ltb4r2 requires several specialized techniques:

  • Gene Cloning and Expression Vector Construction:

    • Isolate Ltb4r2 from rat genomic library using PCR with specific primers

    • Insert the coding sequence into a mammalian expression vector with appropriate promoter elements

  • Expression System Selection:

    • Human embryonic kidney (HEK)-293 cells have proven effective for rat BLT expression

    • Transfect cells using standard protocols (calcium phosphate, lipofection, or electroporation)

  • Purification Strategy:

    • Add affinity tags (His, FLAG) to facilitate purification

    • Use detergent-based membrane protein extraction methods

    • Employ affinity chromatography followed by size exclusion chromatography

  • Verification of Functionality:

    • Perform binding assays with radiolabeled LTB4 to confirm receptor activity

    • Verify signal transduction capability through calcium mobilization assays

Researchers should be aware that as a seven-transmembrane G protein-coupled receptor, Ltb4r2 presents significant challenges in maintaining proper folding and function during purification processes.

How can researchers accurately measure Ltb4r2 expression levels in experimental samples?

Several complementary methods can be employed to measure Ltb4r2 expression:

MethodApplicationAdvantagesLimitations
qPCRmRNA expressionHigh sensitivity, quantitativeDoes not measure protein levels
Northern BlotmRNA detectionDetects transcript size variationsLower sensitivity than qPCR
Western BlotProtein detectionDirectly measures protein levelsRequires specific antibodies
ImmunohistochemistryTissue localizationPreserves anatomical contextSemi-quantitative
Flow CytometryCell-specific expressionSingle-cell resolutionRequires cell isolation

Gene expression profiling using qPCR has been successfully employed to analyze Ltb4r expression in the brainstem of hypertensive rats, revealing dynamic regulation during disease progression . For accurate quantification, expression levels should be normalized to stable reference genes, and technical replicates should be performed to ensure reproducibility.

What are the most suitable experimental models for studying Ltb4r2 function in vivo?

Based on published research, several experimental models have proven valuable for studying Ltb4r2 function:

  • Spontaneously Hypertensive Rat (SHR) Model:

    • Exhibits altered LTB4 receptor signaling in the brainstem

    • Shows increased T cell and macrophage infiltration

    • Demonstrates dynamic regulation of LTB4 production, degradation, and downstream signaling during hypertension development

  • Hepatocellular Carcinoma (HCC) Models:

    • Diethyl nitrosamine (DEN)-induced HCC models reveal roles of Ltb4r2 in cancer progression

    • Allow investigation of interactions between activated hepatic stellate cells and cancer cells

    • Useful for studying the aHSC-initiated 12-HHTrE-Ltb4r2-CTNNB1-YAP1 signaling pathway

  • Transgenic Receptor Models:

    • Overexpression of LTB4 receptors in specific cell populations

    • Used to study receptor function in inflammation and injury from reperfusion

  • Receptor Antagonist Administration Models:

    • Treatment of animals with selective LTB4 receptor antagonists like CP-105,696

    • Allows investigation of receptor blockade effects on physiological parameters like blood pressure

Each model offers unique advantages for investigating specific aspects of Ltb4r2 biology, from basic receptor function to disease intervention strategies.

How does Ltb4r2 activation contribute to inflammatory responses in rat models?

Ltb4r2 activation contributes to inflammatory responses through several mechanisms:

  • Leukocyte Recruitment and Activation:

    • Mediates chemotaxis of neutrophils and other inflammatory cells to sites of inflammation

    • Promotes activation of proteosepeptone-activated peritoneal macrophages

  • Amplification of Inflammatory Circuits:

    • Receptor expression can amplify proinflammatory signaling pathways

    • Creates positive feedback loops involving 5-lipoxygenase (5-LO) signaling

  • Signaling Pathway Activation:

    • Triggers intracellular calcium mobilization

    • Activates downstream effectors leading to altered gene expression

The importance of this receptor in inflammatory responses is highlighted by the finding that blocking LTB4 receptors can significantly reduce inflammation in various experimental models .

What are the methodological approaches for analyzing Ltb4r2 signaling pathways?

Researchers can employ several approaches to analyze Ltb4r2 signaling pathways:

  • Calcium Mobilization Assays:

    • Measure intracellular calcium flux upon receptor activation

    • Use fluorescent calcium indicators in cells expressing Ltb4r2

  • Receptor Binding Studies:

    • Determine binding kinetics of LTB4 and other ligands to Ltb4r2

    • Use competition assays to evaluate potential antagonists

    • Previous studies have established a Kd value of 0.68 nM for LTB4 binding to rat BLT

  • Downstream Signaling Analysis:

    • Western blotting for phosphorylated signaling proteins

    • Analysis of nuclear translocation of transcription factors like CTNNB1 and YAP1

  • Gene Expression Profiling:

    • qPCR analysis of genes regulated by Ltb4r2 activation

    • RNA sequencing to identify global transcriptional changes

  • Pharmacological Intervention:

    • Use of selective receptor antagonists to block specific signaling pathways

    • Analysis of changes in physiological parameters like blood pressure after antagonist administration

What is the role of Ltb4r2 in hepatocellular carcinoma progression?

Research has revealed an important role for Ltb4r2 in hepatocellular carcinoma (HCC) progression:

  • Pro-tumorigenic Signaling Pathway:

    • Ltb4r2 and its high-affinity ligand, 12-hydroxyheptadecatrienoic acid (12-HHTrE), form part of a tumor-promoting signaling pathway

    • Activation of Ltb4r2 leads to nuclear accumulation of CTNNB1 (β-catenin) and YAP1 in tumor cells

  • Cell-Cell Communication in Tumor Microenvironment:

    • Activated hepatic stellate cells (aHSC) release 12-HHTrE, which activates Ltb4r2 on HCC cells

    • Single-cell RNA sequencing has identified a subset of tumor-associated aHSC expressing Cyp1b1 that contributes to 12-HHTrE production

  • Therapeutic Targeting:

    • Genetic or pharmacological inhibition of Ltb4r2 recapitulates CTNNB1 and YAP1 inactivation and tumor suppression

    • Growth of patient HCC organoids is blunted by Ltb4r2 antagonism or knockdown

These findings suggest that targeting the aHSC-initiated 12-HHTrE-Ltb4r2-CTNNB1-YAP1 pathway could represent a novel therapeutic approach for HCC treatment.

How does Ltb4r2 signaling contribute to hypertension development?

Ltb4r2 signaling contributes to hypertension through complex neuro-immune interactions:

  • Brainstem Inflammation:

    • Increased T cell and macrophage infiltration in the brainstem of spontaneously hypertensive rats (SHR)

    • Dynamic regulation of LTB4 production, degradation, and downstream signaling during hypertension development

  • LTB4 Metabolism Regulation:

    • Reduced expression of prostaglandin reductase 1 (Ptgr1), responsible for LTB4 degradation, at the onset stage of hypertension

    • This reduction may contribute to elevated LTB4 levels and sustained receptor activation

  • Autonomic Nervous System Effects:

    • LTB4 receptor signaling affects autonomic control of blood pressure

    • Blocking LTB4 receptor 1 (BLT1) with CP-105,696 reduces arterial pressure in SHR

    • This reduction is associated with decreased low and high-frequency spectra of systolic blood pressure and increased spontaneous baroreceptor reflex gain (sBRG)

These findings identify LTB4 as an important neuro-immune pathway in hypertension development and suggest LTB4 receptors as potential therapeutic targets for neurogenic hypertension.

What methods can be used to develop selective Ltb4r2 antagonists?

Developing selective Ltb4r2 antagonists requires sophisticated approaches:

  • Structure-Based Drug Design:

    • Utilize the known amino acid sequence of rat Ltb4r2 (351 amino acids)

    • Generate homology models based on crystal structures of related GPCRs

    • Perform virtual screening and molecular docking to identify potential binding molecules

  • High-Throughput Screening:

    • Develop cell-based assays with recombinant Ltb4r2 expression

    • Screen compound libraries for inhibition of ligand binding or signaling

    • Follow-up with secondary assays to confirm selectivity over Ltb4r1/BLT1

  • Medicinal Chemistry Optimization:

    • Modify lead compounds to improve potency, selectivity, and pharmacokinetic properties

    • Focus on structural elements that differentiate Ltb4r2 from related receptors

  • Validation in Disease Models:

    • Test candidate antagonists in relevant disease models such as SHR for hypertension or HCC models

    • Assess functional outcomes like blood pressure reduction or tumor suppression

  • Receptor Binding Characterization:

    • Determine binding kinetics and mechanism of antagonism

    • Compare with known binding parameters for LTB4 (Kd value of 0.68 nM for rat BLT)

How can researchers investigate cross-talk between Ltb4r2 and other inflammatory pathways?

Investigating cross-talk between Ltb4r2 and other inflammatory pathways requires integrated experimental approaches:

  • Multi-omics Analysis:

    • Combine transcriptomics, proteomics, and metabolomics to map signaling networks

    • Identify changes in multiple pathways following Ltb4r2 activation or inhibition

  • Signaling Pathway Analysis:

    • Study interactions between Ltb4r2 and pathways like CTNNB1 (β-catenin) and YAP1

    • Investigate counter-regulatory mechanisms like lipoxin A4 (LXA4) signaling

  • Combined Pharmacological Interventions:

    • Use specific inhibitors of multiple pathways simultaneously

    • Assess synergistic or antagonistic effects on disease outcomes

  • Genetic Approaches:

    • Employ conditional knockout models targeting multiple pathway components

    • Use CRISPR/Cas9 technology to create cellular models with specific receptor modifications

  • Cell-Specific Analysis:

    • Study receptor interactions in specific cell types (e.g., polymorphonuclear leukocytes vs. macrophages)

    • Investigate paracrine signaling between different cell populations (e.g., hepatic stellate cells and hepatocellular carcinoma cells)

Understanding these complex interactions could lead to more effective therapeutic strategies targeting multiple inflammatory pathways simultaneously.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.