Recombinant Rat Linker for activation of T-cells family member 1 (Lat)

Shipped with Ice Packs
In Stock

Description

Functional Role in T-Cell Activation

Lat serves as a signaling hub by coupling TCR engagement to downstream pathways:

  • Signal Amplification: Phosphorylation at Y136 initiates PLC-γ1 activation, driving calcium flux and PKC/MAPK signaling .

  • Immune Synapse Formation: Recruits adaptors like SLP-76 to stabilize TCR-microcluster interactions .

  • Threshold Modulation: Mutations (e.g., G135D) accelerate phosphorylation kinetics, altering ligand discrimination and promoting autoimmunity .

Mechanistic Studies

  • TCR Signaling Dynamics: LAT-deficient Jurkat T-cells reconstituted with recombinant Rat Lat reveal its necessity for Ras-Erk activation .

  • Autoimmunity Models: LAT G135D knock-in mice exhibit enhanced thymic negative selection and autoantibody production, mimicking human autoimmune conditions .

Diagnostic and Therapeutic Development

  • ELISA Kits: Detect Lat in serum/plasma with 39 pg/mL sensitivity (detection range: 78–5,000 pg/mL) for monitoring immune dysregulation .

  • Drug Screening: Used to validate inhibitors targeting LAT-PLCG1 interactions in inflammatory diseases .

Key Research Findings

  • Kinetic Proofreading: Delayed LAT phosphorylation relative to TCR-pMHC binding ensures self/non-self discrimination. Disruption (e.g., G135D) causes aberrant responses to weak antigens .

  • Apoptosis Regulation: LAT knockdown in thymoma cells reduces CD8-mediated apoptosis by 90%, highlighting its role in peripheral tolerance .

  • Therapeutic Targets: LAT’s interaction with THEMIS in thymocytes offers potential for modulating autoimmune disorders .

Comparative Insights

While human LAT (UniProt: O43561) shares 85% sequence homology with Rat Lat, species-specific differences in phosphorylation sites (e.g., Y132 in humans vs. Y136 in rats) impact signaling outcomes . Recombinant Rat Lat is preferred for in vivo rodent studies due to minimized cross-species variability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Lat; Linker for activation of T-cells family member 1; 36 kDa phospho-tyrosine adapter protein; pp36; p36-38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Lat
Target Protein Sequence
MEADALSPVELGLLLLPFVVMLLAALCVRCRELPASYDSASTESLYPRSILIKPPQITVPRTPATSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSRQNSDDANSVASYENQEPARKNVDEDEDEDDYPEGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSMESCEDYVNVPESEESAEASLDGSREYVNVSQDAQPVIRAELASVTSQEVEDEEEEDVDGEEAPDYENLQELN
Uniprot No.

Target Background

Function
LAT1 (Linker for activation of T-cells family member 1) is essential for TCR (T-cell antigen receptor) and pre-TCR mediated signaling, both in mature T-cells and during their development. It plays a role in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. LAT1 facilitates coupling of the activation of these receptors and their associated kinases with downstream intracellular events, such as mobilization of intracellular calcium stores, PKC activation, MAPK activation, or cytoskeletal reorganization. This is achieved through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
Gene References Into Functions
  1. Histone hypoacetylation on the LAT promoter can inhibit LAT expression and enhance Th2 differentiation, while trichostatin A, a histone deacetylase inhibitor, promotes LAT expression and inhibits Th2 cytokine production. PMID: 23360572
Database Links

KEGG: rno:81511

STRING: 10116.ENSRNOP00000023563

UniGene: Rn.9773

Subcellular Location
Cell membrane; Single-pass type III membrane protein.
Tissue Specificity
Expressed in NK cells. Present in lymph node, spleen and thymus (at protein level).

Q&A

What is Rat LAT and what role does it play in T-cell signaling?

Rat Linker for Activation of T-cells Family Member 1 (LAT) is a 36 kDa transmembrane adapter protein that serves as a crucial scaffold in T-cell receptor (TCR) signaling pathways. It is phosphorylated by ZAP-70/Syk protein tyrosine kinases following TCR activation, creating binding sites for multiple signaling proteins . LAT functions as a central organizing hub that couples receptor activation to downstream signaling cascades including calcium mobilization, PKC activation, MAPK activation and cytoskeletal reorganization . This occurs through the recruitment of key signaling molecules such as PLCG1, GRB2, and GRAP2, which bind to phosphorylated tyrosine residues on LAT . The protein is primarily expressed in T lymphocytes, platelets, and megakaryocytes, making it essential for proper immune function .

What are the critical structural features of Rat LAT?

Rat LAT is a single-pass type III membrane protein with several functionally important domains . The protein contains multiple tyrosine residues that serve as phosphorylation sites, with four distal tyrosine residues being particularly crucial for signaling functions . The recombinant rat LAT protein typically encompasses residues Leu33-Asp227 (based on accession number O70601), with a predicted molecular mass of 24.7 kDa, though it often appears at approximately 33 kDa in SDS-PAGE analysis due to its structural properties . The protein has an isoelectric point of 4.3, which influences its behavior in various biochemical assays . When expressed recombinantly, rat LAT is often produced with an N-terminal His-tag to facilitate purification, though this tag may influence certain experimental applications and should be considered in experimental design .

How does Rat LAT compare to other species orthologs?

While the basic function of LAT is conserved across species, important structural and functional differences exist. The human and rat LAT proteins share significant sequence homology but exhibit species-specific interaction patterns with downstream signaling molecules . These differences can be critical when translating findings between animal models and human systems. For example, phosphorylation patterns and binding affinities to adaptor proteins may vary between species, potentially affecting signaling outcomes . When designing experiments using rat LAT as a model for human T-cell signaling, researchers should be aware of these species-specific differences and interpret data accordingly . Cross-species validation is recommended when extrapolating mechanistic findings from rat to human systems.

What expression systems are optimal for recombinant Rat LAT production?

The most commonly used expression system for recombinant rat LAT is Escherichia coli, which allows for high-yield production of the protein . When expressing in E. coli, the cytoplasmic domain of LAT (typically residues Leu33-Asp227) is used, as the full-length transmembrane protein can be challenging to express in bacterial systems . For optimal expression, researchers should:

  • Select an appropriate E. coli strain (BL21(DE3) is commonly used)

  • Optimize codon usage for bacterial expression

  • Control induction conditions (temperature, IPTG concentration, duration)

  • Include protease inhibitors during extraction

While E. coli is the predominant system, mammalian cell expression (particularly HEK293) may be preferable when post-translational modifications are critical for the intended application . Insect cell systems can also be considered as an intermediate option that offers some post-translational modifications with higher yield than mammalian systems.

What purification strategies yield the highest purity Rat LAT protein?

For His-tagged recombinant rat LAT, a multi-step purification process typically yields >95% purity as determined by SDS-PAGE . An effective purification protocol includes:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin as the primary capture step

  • Buffer optimization (PBS, pH 7.4, containing 0.01% SKL or Sarcosyl, 1mM DTT)

  • Further purification using ion-exchange chromatography (given LAT's isoelectric point of 4.3)

  • Optional size-exclusion chromatography for removing aggregates and degraded products

The addition of reducing agents such as DTT (1mM) is important to maintain the protein's stability and prevent disulfide-mediated aggregation . For applications requiring removal of the His-tag, protocols using specific proteases (TEV or thrombin) should be optimized to ensure complete tag removal without compromising protein integrity.

How should researchers handle and store recombinant Rat LAT to maintain activity?

Proper handling and storage of recombinant rat LAT is crucial for maintaining its biological activity. Based on manufacturer recommendations, the following protocols are advised :

Storage ConditionRecommended DurationNotes
2-8°C (refrigerated)Up to 1 monthFor frequent use
-20°C (frozen)Up to 12 monthsAliquot to avoid freeze/thaw cycles
-80°C (deep frozen)Up to 12 monthsOptimal for long-term storage

Lyophilized protein is typically more stable and can be reconstituted in PBS (pH 7.4) or specified buffers . When reconstituting, avoid vortexing to prevent protein denaturation. Instead, gently invert or rotate the vial until the protein is completely dissolved. The addition of stabilizers such as 5% trehalose can improve long-term stability . Always work with protein samples on ice and minimize exposure to room temperature during experiments to prevent degradation.

What analytical techniques are most effective for characterizing recombinant Rat LAT?

Multiple analytical techniques should be employed to comprehensively characterize recombinant rat LAT protein:

  • SDS-PAGE and Western Blotting: Assess purity, molecular weight, and identity using anti-LAT or anti-His antibodies

  • Mass Spectrometry: Confirm the exact molecular mass and analyze potential post-translational modifications

  • Circular Dichroism (CD): Evaluate secondary structure and proper folding

  • Dynamic Light Scattering (DLS): Assess protein homogeneity and detect potential aggregation

  • Functional Binding Assays: Verify the ability to interact with known binding partners such as PLCG1, GRB2, or GRAP2

Researchers should pay particular attention to the phosphorylation state of the protein, as unphosphorylated and phosphorylated forms will have different functional properties in experimental settings. For applications requiring phosphorylated LAT, in vitro kinase assays using ZAP-70 or Syk can be performed to generate the active form of the protein.

How can researchers assess the biological activity of recombinant Rat LAT?

To verify that recombinant rat LAT retains its biological activity, several functional assays can be employed:

  • In vitro phosphorylation assays: Using purified ZAP-70 or Syk kinases to assess the capacity of LAT to be phosphorylated at key tyrosine residues

  • Protein-protein interaction studies: Using pull-down assays, surface plasmon resonance, or ELISA-based methods to assess binding to known partners such as PLCG1 or GRB2

  • Cell-based reconstitution assays: Introducing recombinant LAT into LAT-deficient cell lines to rescue signaling defects

  • Phosphorylation-specific antibody recognition: Using antibodies that specifically recognize phosphorylated forms of LAT to confirm proper modification

When designing activity assays, it's crucial to consider that LAT acts as an adapter protein rather than an enzyme, so its "activity" is based on proper folding and the ability to be phosphorylated and subsequently recruit downstream signaling molecules.

What are the key considerations when using LAT-specific antibodies in research?

When using antibodies for LAT detection or immunoprecipitation, researchers should consider several factors:

  • Epitope specificity: Some antibodies recognize specific phosphorylated residues, while others detect total LAT regardless of phosphorylation status

  • Species cross-reactivity: Confirm whether antibodies raised against human LAT cross-react with rat LAT

  • Application compatibility: Validate antibodies for specific applications (Western blot, immunoprecipitation, flow cytometry)

  • Potential interference: The His-tag on recombinant LAT may interfere with antibody binding to certain epitopes

For immunoprecipitation studies, using antibodies directed against different epitopes of LAT can help validate findings and ensure specificity. Phosphorylation-specific antibodies are particularly valuable for studying the dynamics of LAT activation in response to TCR stimulation.

How can recombinant Rat LAT be used as a tool in T-cell signaling research?

Recombinant rat LAT serves as a valuable tool in multiple T-cell signaling research applications:

  • Competitive inhibition studies: Using recombinant LAT to compete with endogenous LAT for binding partners

  • Phosphorylation substrate: As a substrate for in vitro kinase assays with ZAP-70 or Syk

  • Positive control: As a standard in Western blot or ELISA assays

  • Protein-protein interaction mapping: For identifying and validating LAT binding partners

  • Structural studies: As input material for crystallography or cryo-electron microscopy to determine protein complexes

When used in conjunction with cell-based assays, recombinant LAT can help distinguish between effects mediated directly through LAT versus indirect effects through other signaling molecules. The protein can also serve as an immunogen for developing new antibodies or as a blocking agent in immunological assays.

What experimental approaches can elucidate LAT's role in immune disorders?

To investigate LAT's involvement in immune disorders, researchers can employ several experimental approaches:

  • Comparative expression analysis: Measure LAT expression and phosphorylation in samples from healthy versus diseased tissues

  • Mutation analysis: Introduce disease-associated LAT mutations into cellular models to assess functional consequences

  • Phosphoproteomic profiling: Compare LAT phosphorylation patterns between normal and pathological conditions

  • LAT complex composition analysis: Identify differences in LAT-associated protein complexes in disease states

  • Animal models: Use rat models with LAT modifications to study disease phenotypes

These approaches can help elucidate how LAT dysregulation contributes to autoimmune diseases, inflammatory disorders, and immune system dysfunction . Since LAT is a critical node in T-cell signaling, understanding its role in disease contexts could reveal potential therapeutic targets.

How can ELISA systems be optimized for studying LAT biology?

ELISA systems provide powerful tools for studying LAT biology, particularly for quantifying LAT levels and phosphorylation states . To optimize ELISA-based approaches:

  • Antibody selection: Use highly specific antibodies that distinguish between phosphorylated and total LAT

  • Sample preparation: Develop protocols that preserve LAT phosphorylation state during cell lysis

  • Assay validation: Establish standard curves using recombinant LAT at known concentrations

  • Controls: Include appropriate positive (stimulated cells) and negative (unstimulated cells or LAT-deficient cells) controls

The sandwich ELISA format is particularly useful, where capture antibodies target total LAT and detection antibodies recognize specific phosphorylated residues . This approach enables quantitative assessment of LAT activation following various stimuli. Custom ELISA development may be necessary for specific research questions not addressed by commercial kits.

How can recombinant Rat LAT contribute to understanding T-cell receptor signaling kinetics?

Recombinant rat LAT provides a powerful tool for dissecting the kinetics and dynamics of T-cell receptor signaling:

  • In vitro reconstitution systems: Using purified components to reconstruct the TCR signaling cascade, allowing precise control over reaction conditions and component concentrations

  • Real-time binding studies: Employing surface plasmon resonance or biolayer interferometry with immobilized LAT to measure binding kinetics of various signaling proteins

  • Phosphorylation rate determination: Using recombinant LAT as a substrate in kinetic studies of ZAP-70/Syk activity

  • Competitive binding assays: Determining the hierarchy of binding partners to phosphorylated LAT sites

These approaches help elucidate the temporal aspects of LAT-mediated signaling, revealing how different binding partners compete for LAT interaction and how these dynamics impact downstream signaling outcomes. The data obtained can inform computational models of T-cell activation, providing insights into the systems-level properties of immune signaling networks.

What are the current methodological challenges in studying LAT multiprotein complexes?

Studying LAT multiprotein complexes presents several methodological challenges:

  • Complex stability: LAT signaling complexes may be transient or unstable under standard isolation conditions

  • Compositional heterogeneity: Different LAT complexes may form simultaneously in cells, making it difficult to isolate specific complexes

  • Structural determination: The flexible nature of many signaling proteins complicates structural studies of LAT complexes

  • Cellular context dependence: LAT complex formation may depend on cellular factors not present in in vitro systems

Advanced approaches to address these challenges include:

  • Chemical crosslinking combined with mass spectrometry

  • Proximity labeling techniques (BioID, APEX)

  • Super-resolution microscopy to visualize LAT clusters in intact cells

  • Single-molecule tracking to monitor LAT dynamics in living cells

These methods can provide complementary information about LAT complex formation and function in different cellular contexts.

How can systems biology approaches integrate LAT signaling data?

Systems biology approaches offer powerful frameworks for integrating diverse data on LAT signaling:

  • Network analysis: Mapping LAT's position within the broader T-cell signaling network

  • Mathematical modeling: Developing computational models of LAT-dependent signaling dynamics

  • Multi-omics integration: Combining proteomics, phosphoproteomics, and transcriptomics data to understand LAT's impact across cellular processes

  • Sensitivity analysis: Identifying the most critical parameters in LAT signaling through in silico perturbation studies

By leveraging these approaches, researchers can gain insights into how LAT functions as a critical node in T-cell signaling networks . Systems-level analysis can also reveal emergent properties not obvious from reductionist studies, such as feedback loops, signal amplification, and pathway crosstalk involving LAT.

What are common challenges in working with recombinant Rat LAT and how can they be addressed?

Researchers often encounter several challenges when working with recombinant rat LAT:

ChallengePotential Solutions
Protein aggregationInclude reducing agents (DTT/BME), optimize buffer conditions, use stabilizing additives like trehalose
Low solubilityExpress as fusion protein with solubility tags, optimize detergent concentration for membrane-associated constructs
Degradation during expressionReduce induction temperature, co-express with chaperones, add protease inhibitors during purification
Inconsistent phosphorylationUse standardized in vitro kinase reactions, validate phosphorylation with phospho-specific antibodies
His-tag interferenceConsider tag removal for functional studies, validate that tag doesn't affect protein interactions

Thorough quality control testing after each preparation is essential for ensuring consistent experimental results. This includes SDS-PAGE analysis, Western blotting, and functional binding assays to confirm protein integrity and activity.

How can researchers distinguish between specific and non-specific effects in LAT functional studies?

Distinguishing specific from non-specific effects is crucial for accurate interpretation of LAT functional studies:

  • Multiple controls: Include appropriate negative controls (non-phosphorylated LAT, LAT with mutated binding sites)

  • Concentration dependence: Perform dose-response experiments to identify specific interaction thresholds

  • Competition assays: Use peptides corresponding to specific LAT regions to compete with full-length protein

  • Mutational analysis: Compare wild-type LAT with point mutants affecting specific functions

  • Specificity validation: Confirm interactions persist under high-stringency conditions

For cell-based studies, complementary approaches such as siRNA knockdown of LAT combined with reconstitution using recombinant protein can help validate specificity. Additionally, using antibodies that block specific regions of LAT can help delineate which interactions are functionally relevant in a given context.

What statistical approaches are recommended for analyzing LAT-dependent signaling data?

Analyzing LAT-dependent signaling data requires robust statistical approaches:

  • Normalization methods: Account for variations in protein loading or cell number when comparing phosphorylation levels

  • Time-course analysis: Apply repeated measures ANOVA or mixed-effects models for temporal phosphorylation data

  • Correlation analysis: Assess relationships between LAT phosphorylation and downstream events

  • Multiple comparison corrections: Apply appropriate corrections (Bonferroni, FDR) when testing multiple phosphorylation sites

  • Power analysis: Determine appropriate sample sizes to detect biologically meaningful differences

When analyzing complex datasets involving multiple phosphorylation sites or signaling outputs, multivariate statistical methods such as principal component analysis can help identify patterns and key variables. For systems-level analyses, specialized computational approaches such as Bayesian network inference may be valuable for reconstructing signaling networks involving LAT.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.