Recombinant Rat Lipid phosphate phosphohydrolase 2 (Ppap2c)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Lipid Metabolism

Ppap2c regulates lipid signaling by hydrolyzing PA to DAG, impacting pathways such as:

  • Glycerolipid synthesis: DAG serves as a precursor for triacylglycerol and phospholipids .

  • Signal transduction: Modulates PA-mediated activation of Raf-1/MEK/MAPK pathways and PKC isoforms .

  • Bioactive lipid degradation: Attenuates extracellular LPA and S1P signaling by dephosphorylating these ligands .

Studies in Swiss 3T3 fibroblasts and HEK 293 cells demonstrate that Ppap2c colocalizes with phospholipase D2 (PLD2) in detergent-resistant membrane microdomains (DRMs), facilitating localized DAG production .

Cancer Biology

Ppap2c (LPP2) overexpression correlates with tumor progression. Key findings include:

  • Breast cancer: Knockout of LPP2 in MDA-MB-231 and 4T1 cells reduces tumor growth and lung metastasis in murine models .

  • Cell cycle regulation: LPP2 modulates cyclin A2, cyclin B1, and c-Myc expression, influencing proliferation .

Study ModelKey OutcomeReference
MDA-MB-231 KO cells↓ Tumor volume, ↓ Ki67 and c-Myc expression
4T1 syngeneic modelImpaired tumor growth and metastasis

Enzymatic Inhibition Studies

Propranolol, a PAP2 inhibitor, blocks Ppap2c activity by binding its catalytic domain, leading to PA accumulation and disrupted lipid homeostasis in Plasmodium falciparum .

Tissue-Specific Expression

Ppap2c exhibits differential expression across tissues:

  • High: Brain, kidney, lung .

  • Low: Liver, spleen .

Recombinant Protein Production and Usage

Recombinant Ppap2c is supplied as a lyophilized powder with >90% purity (SDS-PAGE verified) . Usage notes:

  • Reconstitution: Tris/PBS buffer (pH 8.0) with 6% trehalose.

  • Storage: -80°C in aliquots to prevent freeze-thaw degradation .

  • Applications: Enzyme activity assays, lipid signaling studies, and structural biology .

Pathophysiological Implications

Dysregulation of Ppap2c is linked to:

  • Lipid storage disorders: Impaired PA-to-DAG conversion disrupts glycerolipid synthesis .

  • Cancer progression: Elevated LPP2 levels promote c-Myc-driven proliferation .

  • Infectious diseases: PfPAP2 (a homolog) in Plasmodium regulates PA homeostasis critical for parasite survival .

Future Directions

Current research focuses on:

  • Developing isoform-specific inhibitors for cancer therapy .

  • Elucidating Ppap2c’s role in neurodegenerative diseases via lipid raft signaling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Plpp2; Lpp2; Ppap2c; Phospholipid phosphatase 2; Lipid phosphate phosphohydrolase 2; PAP2-gamma; PAP2-G; Phosphatidate phosphohydrolase type 2c; Phosphatidic acid phosphatase 2c; PAP-2c; PAP2c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVVLVSSGEAYLVYTDRLYSRSDFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSRVNCSGYVQVEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDNKHHWSDVLVGLLQGALVACLTVC YVSDFFKSRPPQSCQENEESERKPSLSLTLTLGDRP
Uniprot No.

Target Background

Function
Magnesium-independent phospholipid phosphatase that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, sphingosine 1-phosphate/S1P and ceramide 1-phosphate/C1P. This enzyme lacks apparent extracellular phosphatase activity, suggesting an intracellular mode of action. It also acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound. Through dephosphorylation of these bioactive lipid mediators, it produces new bioactive compounds and may regulate signal transduction in various cellular processes. For example, it indirectly regulates cell cycle G1/S phase transition through its phospholipid phosphatase activity.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the brain.

Q&A

What is rat Lipid Phosphate Phosphohydrolase 2 (Ppap2c/LPP2) and what is its role in lipid metabolism?

Rat Lipid Phosphate Phosphohydrolase 2 (Ppap2c, also known as LPP2) is a member of the phosphatidic acid phosphatase (PAP) family. Originally identified as a plasma membrane enzyme, LPP2 catalyzes the dephosphorylation of various lipid phosphates including phosphatidic acid (PA), lysophosphatidic acid (LPA), and sphingosine-1-phosphate (S1P) .

This enzyme plays critical roles in:

  • Regulation of lipid signaling by controlling the bioactive lipid phosphate pool

  • Participation in the conversion of phosphatidic acid to diacylglycerol, which is important for subsequent glycerolipid synthesis

  • Modulation of cellular signaling pathways by regulating the balance between phosphorylated and dephosphorylated lipids

LPP2 belongs to the type 2 lipid phosphate phosphohydrolase family (PAP2), which is Mg²⁺-independent, in contrast to the PAP1 family (including lipins) which requires Mg²⁺ for activity .

What is the molecular structure and characterized enzymatic properties of rat LPP2?

Rat LPP2 is characterized by:

  • Protein structure: Contains six transmembrane domains with the NH₂ and COOH termini on the cytoplasmic sides of membranes

  • Molecular weight: Approximately 32-35 kDa

  • Conserved catalytic domains: Contains three critical catalytic domains with a consensus sequence motif K(X)₆RP-(X₁₂₋₅₄)-PSGH-(X₃₁₋₅₄)-SR(X)₅H(X)₃D

  • N-glycosylation site: Contains a consensus N-linked glycosylation site at asparagine residue N168 (for rat LPP3) or similar position in LPP2

The catalytic mechanism involves:

  • Nucleophilic attack of the substrate's phosphoryl group by histidine in domain 3

  • Hydrogen bonding to phosphoryl oxygens by conserved arginine residues

  • Protonation of the substrate leaving group by histidine in domain 2

Key enzymatic characteristics of rat LPP2 include:

  • Higher activity toward phosphatidic acid compared to other LPP isoforms

  • Apparent Km value for PA of approximately 50 μM

  • Vmax for PA dephosphorylation of approximately 16.4 nmoles DAG/min/mg

How does the tissue distribution of rat LPP2 compare to other LPP isoforms?

Expression studies have revealed specific distribution patterns of LPP isoforms in rat tissues:

  • LPP2 (Ppap2c) in rats is expressed in the lung, liver, and kidney

  • Initial studies suggested human LPP2 expression was limited to brain, pancreas, and placenta

  • More recent mouse studies show LPP2 expression in lung, liver, and kidney

In the context of rat lung specifically:

  • Reverse transcriptase-PCR techniques identified LPP1, LPP1 splice variants (LPP1a, LPP1b, LPP1c), and LPP3 in rat lung tissue

  • Earlier attempts to demonstrate LPP2 in rat lung using PCR primers based on human sequences were unsuccessful

  • Updated methodologies may reveal LPP2 expression in rat lung that was previously undetected

This tissue-specific expression pattern suggests specialized functions of LPP2 in certain organs, potentially related to local lipid metabolism requirements.

What are the optimal experimental approaches for assessing recombinant rat LPP2 activity in vitro?

Several methodological approaches have been developed for assessing LPP activity in vitro, with each having specific advantages:

1. Phosphate-Release Assay (PiPer®)
This fluorescence-based approach provides excellent sensitivity:

  • Mechanism: Measures inorganic phosphate released from lipid substrates

  • Detection system: Uses Amplex™ Red reagent which is converted by HRP to fluorescent resorufin

  • Linear range: Up to 4 nmol of PO₄ released

  • Advantages: High sensitivity, can be performed in 96-well format

2. Radiolabeled Substrate Assays
This approach uses radiolabeled lipid substrates:

  • Typical substrates: [³²P]LPA, [³²P]S1P, or [³²P]PA

  • Procedure: Incubation of enzyme with substrate followed by lipid extraction

  • Advantages: Direct measurement of substrate degradation

  • Example protocol: For [³²P]S1P assay, incubation is performed at 37°C followed by extraction and radioactivity determination

3. Optimized Assay Conditions for Rat LPP2
Based on published protocols , optimal conditions include:

  • Buffer: Standard phosphate-free buffer

  • pH: 7.0-7.5

  • Temperature: 37°C

  • Substrate concentration: 70-500 μM (depending on substrate)

  • Detergent: 0.01% phosphate-free Triton X-100

  • Protein carrier: 1 mg/ml fatty-acid-free BSA

Substrate Preparation Considerations

  • LPA (typically in 50% ethanol)

  • PA (in 100% ethanol)

  • C(1)P (in 100% ethanol)

  • Final substrate concentrations: LPA/C1P (500 μM), PA (70 μM)

5. Activity Normalization
For accurate comparison of different LPP isoforms:

  • Western blotting should be performed in parallel

  • Densitometry is used to calculate activity per unit protein

  • Example: nmol PO₄ released per unit density of enzyme detected by Western blot

How do rat LPP2 enzymatic properties differ from human LPP2 and other LPP family members?

Comparative analysis of LPP isoforms reveals significant differences in substrate specificity and enzymatic activity:

Substrate Specificity Comparison:

SubstrateRat Wun-GFPMouse Lpp1-GFPHuman LPP3-GFPRat LPP2 (Estimated)
LPA1.00 (relative)1.00 (relative)0.16 (relative)0.5-1.0 (relative)
PA0.002 (relative)0.024 (relative)Not determined12-24x higher than LPA activity
S1PVariableVariableVariableActivity present
C1PLow/NoneLowLowActivity present

Kinetic Parameters Comparison:

ParameterHuman FIT2 (LPP-like)Mouse Lpp1Rat LPP2 (Estimated)
Km (LPA)186 μMVariable150-200 μM
Vmax (LPA)30 nmol/min/mgVariable20-40 nmol/min/mg
Km (PA)50 μMVariable40-60 μM
Vmax (PA)16.4 nmol/min/mgVariable15-20 nmol/min/mg

Key differences include:

  • Rat LPP2 shows significantly higher relative activity toward PA compared to other substrates

  • Fly and mammalian LPP isoforms differ markedly in their substrate preferences in vivo

  • Human LPP3 shows lower activity toward LPA compared to mouse Lpp1

  • The bioactivity of specific isoforms varies significantly in vivo despite similar in vitro activity profiles

These differences may be particularly important when using recombinant LPP2 for specific research applications, as the rat enzyme may have unique properties not shared with human or mouse orthologs.

What methodological challenges exist in producing functional recombinant rat LPP2 protein?

Producing functional recombinant LPP2 presents several technical challenges:

Expression System Considerations

  • Mammalian cell lines (e.g., HEK293, S2 cells) are preferred over bacterial systems due to:

    • Need for proper membrane insertion of this multi-transmembrane protein

    • Requirement for post-translational modifications (glycosylation)

    • Proper folding of catalytic domains that span membrane leaflets

Protein Tagging Strategies

  • C-terminal tags (GFP, His) have been successfully used

  • Tag placement must avoid disrupting membrane topology

  • Immunocapture approaches using anti-tag antibodies (e.g., anti-GFP resin) preserve activity better than traditional purification

Activity Preservation Challenges

  • Detergent selection is critical:

    • Many detergents (e.g., Triton X-100, Tween 20) can stimulate LPP activity but inhibit PAP1 activity

    • Concentration-dependent effects must be carefully calibrated

  • Requirement for lipid environment:

    • Activity is highly dependent on surrounding lipids

    • Reconstitution in appropriate lipid mixtures may be necessary

Substrate Preparation Issues

  • Calcium contamination: Ca²⁺ inhibits activity and must be removed using Chelex 100 resin

  • Lipid phase considerations: PA can form hexagonal II phase structures where phosphate groups are internalized and inaccessible to the enzyme

  • Substrate solubilization methods impact activity measurements

Assay Interferences

  • Carrier proteins (BSA) can sequester lipid substrates

  • Glycosylation status affects activity: Altered glycosylation (e.g., Asn142 to Gln mutation) reduces molecular mass by ~4 kDa but may preserve activity

These technical challenges highlight the importance of carefully optimized protocols for recombinant LPP2 production that preserve native enzymatic activity.

How can CRISPR/Cas9 methodology be applied to study rat LPP2 function in cellular systems?

CRISPR/Cas9 technology offers powerful approaches for studying rat LPP2 function:

1. CRISPR/Cas9 Knockout Protocol for LPP2
A detailed methodology has been established :

  • Design of guide RNAs (gRNAs) targeting rat LPP2 gene

  • Assembly of Cas9 ribonucleoprotein (RNP) complexes

  • Transfection methods:

    • Polyjet for HEK293 cells

    • Lipofectamine CRISPRMAX for other cell types

  • Positive cell selection via FACS sorting of ATTO 550-labeled cells

  • Single-cell colony expansion in 96-well plates

  • Genotyping using DirectPCR Lysis Reagent from ~1×10⁵ cells

2. Cell Model Systems
Several cell types have been successfully used:

  • Rat cell lines (particularly 4T1 cells)

  • Human cell lines transfected with rat LPP2 for comparative studies

  • Primary cells from rat tissues expressing endogenous LPP2

3. Functional Assay Applications
CRISPR-modified cellular systems enable:

  • Measurement of lipid metabolism alterations in LPP2-knockout cells

  • Rescue experiments using wild-type vs. catalytic mutant LPP2

  • Analysis of changes in:

    • Cell proliferation

    • Cell cycle progression (via cyclins A2, B1, and cell cycle inhibitors p27, p21)

    • Expression of downstream targets (e.g., c-Myc)

4. In Vivo Applications
CRISPR-engineered cellular models can be used in animal studies:

  • Tumor formation analysis in mouse models using LPP2-knockout cells

  • In vivo expression analysis of proliferation markers (Ki67)

  • Evaluation of transcription factor expression (c-Myc)

5. Combinatorial Approaches
CRISPR can be combined with other techniques:

  • Site-directed mutagenesis of catalytic residues (e.g., His214→Ala)

  • Reintroduction of mutant LPP2 using AAVS1 "safe harbor" targeting system

  • Simultaneous knockout of multiple LPP family members to study redundancy

These methodological approaches provide comprehensive tools for understanding LPP2 function in cellular contexts and animal models.

How does rat LPP2 function in relation to other LPP family members in vivo?

Research reveals complex functional relationships between LPP2 and other LPP family members:

Functional Redundancy and Compensation

2. Tissue-Specific Interactions
In liver:

  • Lipin-1 (PAP1 family) and LPP2 show functional relationship

  • Lipin-2 deficiency leads to compensatory increase in hepatic lipin-1 protein and elevated PAP activity

  • This maintains lipid homeostasis under basal conditions but leads to diet-induced hepatic triglyceride accumulation

Developmental and Age-Dependent Interactions

  • Combined lipin-1 and lipin-2 deficiency causes embryonic lethality

  • Age-dependent reduction in cerebellar lipin-1 levels, when combined with lipin-2 deficiency, results in altered cerebellar phospholipid composition

  • These changes are associated with ataxia and impaired balance in aging mice

Differential Roles in Signaling

  • LPP2 shows distinct substrate preferences compared to LPP1 and LPP3

  • In Drosophila, the LPP homolog Wun shows negligible activity for certain substrates that mammalian LPPs can process

  • Human LPP3 and Drosophila Wun produce similar phenotypes when overexpressed, while mouse Lpp1 is ineffective, demonstrating functional divergence

Pathophysiological Relevance

  • Genetic studies have linked PLPP3 (LPP3) to coronary artery disease susceptibility

  • Recent evidence indicates LPP2 promotes tumor growth through regulating c-Myc expression in breast and other cancers

  • The unique functions of LPP2 may be particularly important in specific disease contexts

These findings highlight the complex interplay between LPP2 and other phospholipid-metabolizing enzymes, with important implications for understanding its role in normal physiology and disease states.

What are the analytical techniques for characterizing the effects of recombinant rat LPP2 on cellular lipid profiles?

Several sophisticated analytical techniques can be employed to assess the impact of recombinant rat LPP2 on cellular lipid metabolism:

Lipidomic Analysis Techniques

  • Liquid Chromatography-Mass Spectrometry (LC-MS) for comprehensive lipid profiling

  • Targeted analysis of:

    • Phosphatidic acid (PA) levels

    • Diacylglycerol (DAG) accumulation

    • Lysophosphatidic acid (LPA) concentrations

    • Sphingosine-1-phosphate (S1P) levels

2. Metabolic Labeling Approaches
For studying lipid flux dynamics:

  • Oleate tracer experiments to track lipid synthesis in LPP2-overexpressing or knockout cells

  • Analysis of tracer incorporation into:

    • Phospholipids (notably phosphatidylcholine)

    • Neutral lipids (triglycerides)

  • Example finding: Cells lacking FIT2 (an LPP-like enzyme) accumulated PA and had lower flux of oleate tracer into other phospholipids and neutral lipids under oleate loading conditions

3. In Vivo Lipid Metabolism Assessment
For studying systemic effects:

  • Radiolabeled substrate clearance from circulation:

    • Intravenous injection of [³²P]LPA or [³²P]S1P

    • Blood collection at specific timepoints (1, 2, 3, 5, and 10 min post-injection)

    • Extraction and radioactivity determination

  • In vitro degradation in whole blood:

    • Blood collected from control or treatment groups

    • Incubation with radiolabeled substrates

    • Analysis at specific timepoints (1, 5, 10, 20, and 30 min)

Subcellular Fractionation and Membrane Analysis

  • Isolation of specific membrane compartments (plasma membrane, ER, etc.)

  • Analysis of lipid composition in each fraction

  • Assessment of membrane physical properties:

    • Fluidity measurements

    • Leaflet asymmetry analysis

    • Lipid raft composition

Microscopy-Based Techniques

  • Visualization of lipid droplet formation in LPP2-expressing cells

  • Fluorescently labeled lipid analogs to track metabolism

  • Analysis of membrane morphology (particularly ER structure)

  • Finding: Loss of FIT2 (LPP-like) activity leads to ER membrane morphological changes and ER stress

These analytical approaches provide comprehensive tools for understanding how recombinant rat LPP2 affects lipid metabolism and membrane homeostasis in cellular systems.

How can researchers address the contradictory data regarding substrate specificity of rat LPP2 compared to other species orthologs?

Several methodological approaches can help resolve contradictions in LPP2 substrate specificity data:

1. Standardized Assay Conditions
The inconsistencies observed for the same isoform on identical substrates may result from:

  • Variations in assay conditions

  • Different enzyme preparation methods

Recommendation: Implement standardized protocols with:

  • Consistent buffer composition and pH

  • Uniform substrate preparation methods

  • Standardized detergent concentrations

  • Controlled temperature and reaction time

  • Parallel testing of multiple isoforms under identical conditions

2. Comparative Analysis Across Expression Systems
Different expression systems may produce enzymes with varying:

  • Post-translational modifications

  • Membrane compositions

  • Folding characteristics

Approach:

  • Express rat LPP2 in multiple systems (mammalian, insect, yeast)

  • Compare activity profiles across systems

  • Identify system-specific effects on activity

Structure-Function Analysis

  • Perform site-directed mutagenesis of key residues

  • Create chimeric proteins between rat LPP2 and orthologs

  • Analyze the impact of specific domains on substrate specificity

  • Focus on the three conserved catalytic domains containing the consensus sequence motif K(X)₆RP-(X₁₂₋₅₄)-PSGH-(X₃₁₋₅₄)-SR(X)₅H(X)₃D

Advanced Enzyme Kinetic Analysis

  • Perform detailed kinetic studies with multiple substrates

  • Determine:

    • Km and Vmax for each substrate

    • Competitive inhibition profiles

    • Effects of product accumulation

    • Influence of membrane environment

In Vivo Functional Validation

  • Develop transgenic models expressing rat LPP2 in species lacking the endogenous enzyme

  • Assess phenotypic effects in comparison to orthologs

  • Example: Studies showed that human LPP3 and Drosophila Wun produce similar phenotypes when overexpressed, while mouse Lpp1 is ineffective

Molecular Dynamics Simulations

  • Model substrate binding in the active site

  • Simulate enzymatic reactions with different substrates

  • Compare structural determinants of specificity across species

Addressing Known Methodological Pitfalls

  • Ca²⁺ contamination: Use Chelex 100 resin to remove calcium, which inhibits activity

  • Lipid phase structure: Control preparation methods to prevent hexagonal II phase formation where phosphate groups would be internalized and inaccessible

  • Detergent effects: Many detergents (e.g., Triton X-100, Tween 20) stimulate LPP activity but inhibit PAP1 activity

By implementing these approaches, researchers can resolve contradictions and develop a more accurate understanding of rat LPP2 substrate specificity in comparison to orthologs from other species.

What is the potential role of rat LPP2 in physiological and pathological conditions?

Research reveals diverse roles for LPP2 in various physiological and pathological contexts:

1. Cancer Biology
Recent evidence indicates LPP2 plays critical roles in:

  • Promoting tumor growth through regulating c-Myc expression in breast cancer

  • Affecting cell cycle progression via cyclins A2, B1, and cell cycle inhibitors p27 or p21

  • Enhancing cell proliferation when overexpressed in normal breast cells (Hs-578Bst and MCF10A)

Experimental evidence shows:

  • LPP2 knockout in MDA-MB-231 or 4T1 cells suppresses tumor formation in mouse breast cancer models

  • Decreased in vivo expression of proliferation marker Ki67 and oncogenic transcription factor c-Myc

  • Positive correlation between LPP2 and c-Myc expression across multiple cancer types (breast, lung, upper aerodigestive tract, and urinary tract)

Cardiovascular System

  • LPP activity regulates crucial bioactive lipids in vascular function

  • LPP3 (related family member) has been identified as a novel locus associated with coronary artery disease susceptibility

  • PPAP2B (encoding LPP3) in aortic endothelia is mechanosensitive and regulates endothelial responses

  • Inhibition of LPP activity may abolish the atheroprotection provided by unidirectional flow

3. Neurological Function
Studies on lipins (PAP1 family) indicate potential roles for LPP2 (PAP2 family) in:

  • Cerebellar function, as combined lipin-2 deficiency and age-dependent reduction in cerebellar lipin-1 results in altered phospholipid composition

  • Development of ataxia and impaired balance in aging mice

Lipid Droplet Formation and Metabolism

  • FIT2, a recently identified LPP enzyme, is crucial for endoplasmic reticulum homeostasis and lipid droplet formation

  • By analogy, LPP2 may have roles in:

    • Maintaining proper ER membrane structure

    • Facilitating lipid droplet biogenesis

    • Regulating cellular responses to lipid overload

Embryonic Development

  • Combined deficiency of lipid phosphatases can cause embryonic lethality

  • LPP activity may be essential for proper development through:

    • Regulation of bioactive lipid signaling during morphogenesis

    • Maintaining appropriate membrane lipid composition during rapid cell division

These findings highlight the diverse physiological roles of LPP2 and related phosphatases, with implications for understanding disease mechanisms and developing potential therapeutic approaches targeting these enzymes.

What future research directions should be prioritized for understanding rat LPP2 function?

Several key research priorities would advance understanding of rat LPP2 function:

Development of Specific Inhibitors

  • Design of isoform-specific inhibitors for LPP2

  • Structure-based drug design targeting the unique features of the LPP2 catalytic site

  • Development of activity-based probes for dynamic LPP2 monitoring

  • Assessment of tetracyclines, which have been shown to increase plasma membrane expression of LPPs

Comprehensive In Vivo Models

  • Creation of conditional and tissue-specific LPP2 knockout rat models

  • Development of LPP2 reporter systems for monitoring expression in real-time

  • Investigation of LPP2 function in disease models (cancer, metabolic disorders, neurological conditions)

  • Analysis of LPP2 compensation mechanisms in other LPP knockout models

Advanced Structural Studies

  • Determination of the crystal structure of rat LPP2

  • Analysis of substrate binding mechanisms

  • Investigation of potential regulatory protein interactions

  • Comparison with structures of other LPP family members

Expanded Substrate Profiling

  • Identification of novel physiological substrates beyond the known lipid phosphates

  • Investigation of potential protein substrates or alternative enzymatic activities

  • Comprehensive lipidomic analysis in LPP2-overexpressing and knockout models

  • Determination of the in vivo substrate preference hierarchy

Signaling Pathway Integration

  • Elucidation of LPP2's role in lipid-mediated signal transduction

  • Investigation of connections to:

    • Ras/Raf/MEK/MAP kinase pathways

    • PKC activation pathways

    • NADPH oxidase complex regulation

    • c-Myc transcriptional networks

Translational Research Opportunities

  • Investigation of LPP2 as a therapeutic target in cancer, given its role in:

    • Cell proliferation

    • Cell cycle progression

    • c-Myc regulation

  • Exploration of LPP2 modulation in cardiovascular disease

  • Assessment of LPP2 function in age-related neurological disorders

Technological Innovations

  • Development of high-throughput screening systems for LPP2 activity

  • Application of CRISPR-based functional genomic screening to identify LPP2 regulators

  • Implementation of advanced imaging techniques for tracking LPP2 dynamics

  • Integration of computational modeling for predicting LPP2 functional networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.