Recombinant Rat Lipid phosphate phosphohydrolase 3 (Ppap2b)

Shipped with Ice Packs
In Stock

Description

Research Findings and Functional Insights

PPAP2B regulates lipid signaling pathways with implications for vascular health and disease.

Role in Atherosclerosis

  • LPA Metabolism: PPAP2B suppresses LPA signaling by hydrolyzing extracellular LPA, preventing receptor-mediated inflammation and smooth muscle cell migration .

  • Experimental Models:

    ModelOutcomeSource
    Plpp3 knockout miceIncreased plaque-associated LPA, atherosclerosis, and macrophage infiltration .
    Liver-specific Plpp3 deletionElevated plasma pro-atherogenic lipids (e.g., LPA, S1P) .

Wnt Signaling Regulation

PPAP2B inhibits Wnt/β-catenin signaling, critical for embryonic development and cancer. In Plpp3-null mice, upregulated Wnt signaling leads to vascular defects and axis duplication .

Tissue-Specific Expression

TissueExpression LevelFunctionSource
BrainHighCerebellar development and lipid homeostasis .
Kidney/LungModeratePA/LPA metabolism and vascular maintenance .
LiverCritical for lipid exportRegulates plasma lipid composition .

Coronary Artery Disease (CAD)

  • Genetic Association: The PPAP2B locus is linked to CAD risk in GWAS, independent of traditional factors like cholesterol .

  • Mechanism: Reduced PPAP2B expression increases LPA bioavailability, promoting endothelial dysfunction and plaque instability .

Targeting LPA Signaling

  • Pharmacological Interventions: Inhibitors of LPA receptors (e.g., ATX) or PPAP2B enhancers may mitigate atherosclerosis .

Recombinant Protein Production

While direct data on rat PPAP2B is sparse, recombinant human PPAP2B is produced in E. coli with His-tag purification, achieving >90% purity . Similar methods likely apply to rat variants.

ParameterValueSource
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0

Experimental Models

  • Tissue-Specific Knockouts: Endothelial or smooth muscle cell-specific Plpp3 deletion in mice clarifies its role in atherosclerosis .

  • Lipidomics: Plasma LPA/S1P profiling in Plpp3-deficient models identifies pro-atherogenic lipid signatures .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize the development of the specified tag if possible.
Synonyms
Plpp3; Lpp3; Ppap2b; Phospholipid phosphatase 3; Differentially expressed in rat intestine 42; Dri42; Lipid phosphate phosphohydrolase 3; PAP2-beta; Phosphatidate phosphohydrolase type 2b; Phosphatidic acid phosphatase 2b; PAP-2b; PAP2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILRIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPV DIMDRSNHHNMV
Uniprot No.

Target Background

Function
Lipid phosphate phosphohydrolase 3 (PPAP2B), also known as magnesium-independent phospholipid phosphatase, is a transmembrane enzyme that catalyzes the dephosphorylation of various glycerolipid and sphingolipid phosphate esters. These include phosphatidate (PA), lysophosphatidate (LPA), diacylglycerol pyrophosphate (DGPP), sphingosine 1-phosphate (S1P), and ceramide 1-phosphate (C1P). PPAP2B also acts on N-oleoyl ethanolamine phosphate, a potential physiological compound.
PPAP2B exhibits both extracellular and intracellular phosphatase activity, allowing the hydrolysis and cellular uptake of these bioactive lipid mediators from the surrounding environment. This regulation of signal transduction is essential in diverse cellular processes.
PPAP2B plays a crucial role in vascular homeostasis by dephosphorylating extracellular S1P and regulating its extra- and intracellular availability. This activity influences endothelial cell migration, adhesion, survival, proliferation, and the production of pro-inflammatory cytokines. By maintaining appropriate S1P levels in the cerebellum, PPAP2B also ensures its proper development and function.
Through its intracellular lipid phosphatase activity, PPAP2B may participate in early compartments of the secretory pathway, regulating the formation of Golgi to endoplasmic reticulum retrograde transport carriers.
Beyond its phosphatase activity, PPAP2B can function in the Wnt signaling pathway and the stabilization of beta-catenin (CTNNB1). This regulatory activity influences cell proliferation, migration, and differentiation in angiogenesis and tumor growth. PPAP2B also plays a role in integrin-mediated cell-cell adhesion in angiogenesis.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.
Tissue Specificity
Detected in epithelial cells of intestinal mucosa, lung, liver and brain.

Q&A

Basic Research Questions

  • What is the structure and function of Lipid phosphate phosphohydrolase 3 (Ppap2b/LPP3)?

    LPP3 is a member of the PAP-related phosphoesterase family that functions as a type 2 phosphatidic acid phosphatase. Structurally, LPP3 contains six hydrophobic transmembrane domains and a hydrophilic catalytic site composed of three conserved domains (C1, C2, and C3) . The catalytic site faces the extracellular matrix when located on the cell membrane and faces the lumen when located in intracellular membranes .

    The three conserved domains form the catalytic center where C1 is responsible for substrate recognition, while C2 and C3 contain amino acids required for the phosphotransferase reaction . The conserved histidine on C3 acts as a nucleophile to form a phospho-histidine intermediate, and the C2 histidine is involved in breaking the phosphate bond to release the dephosphorylated lipid product .

    Functionally, LPP3 hydrolyzes extracellular lysophosphatidic acid (LPA), sphingosine-1-phosphate (S1P), and other phospholipids. This activity regulates vascular and embryonic development by modulating lipid signaling pathways associated with cardiovascular disease, cancer, and developmental processes .

  • What are the substrate specificities of Rat LPP3 compared to other LPP family members?

    Rat LPP3 exhibits broad substrate specificity but demonstrates distinct preferences compared to other family members. It dephosphorylates various substrates including:

    SubstrateLPP3 ActivityLPP1 ActivityLPP2 Activity
    Lysophosphatidic acid (LPA)HighHighHigh
    Sphingosine-1-phosphate (S1P)HighModerateLow
    Phosphatidic acid (PA)HighHighHigh
    Ceramide-1-phosphate (C1P)ModerateModerateLow
    FTY720-phosphateHighLow (LPP1a high)Low
    N-oleoyl ethanolamine phosphatePresentPresentPresent

    LPP3 and LPP1a (a splice variant of LPP1) are more efficient at hydrolyzing S1P than LPP1 and LPP2 . When testing FTY720-phosphate (an S1P analog used in multiple sclerosis treatment), only LPP3 and LPP1a showed significant dephosphorylation activity . In HEK293 cells expressing exogenous LPP enzymes, all enhanced ecto-activity against LPA, but only LPP3 significantly increased degradation of extracellular S1P .

  • How does LPP3 influence embryonic development in knockout models?

    LPP3 plays a critical role in embryonic development, with knockout studies revealing:

    Complete knockout of LPP3 in mice is embryonically lethal, with embryos failing to form a chorio-allantoic placenta and yolk sac vasculature . Lethality occurs in two waves - the first between E8.5 and E10.5, and the second between E11.5 and E13.5 .

    Histological analysis of E11.5 embryos with endothelial cell-specific knockout of LPP3 (ECKO) showed:

    • Insufficient heart growth

    • Decreased trabeculation

    • Reduced growth of the compact wall

    • Absence of cardiac cushions

    • Presence of apoptotic endothelial cells

    Some embryos from LPP3 knockout mice showed shortening of the anterior-posterior axis similar to axin deficiency, suggesting LPP3 may function as a Wnt signaling antagonist . These developmental abnormalities indicate LPP3's essential role in early mouse development, with particular importance in vascular formation and cardiac development .

  • What methodologies are most effective for measuring LPP3 enzymatic activity?

    Several methodologies have proven effective for measuring recombinant Rat LPP3 enzymatic activity:

    In vitro assays using radiolabeled substrates:

    • Incubate purified or membrane-bound LPP3 with [32P]-labeled LPA or S1P

    • Extract lipids using butanol extraction

    • Measure radioactivity to determine degradation rates

    • Time points typically range from 1-30 minutes at 37°C

    Whole cell assays for ecto-phosphatase activity:

    • Culture cells expressing recombinant LPP3

    • Add exogenous substrates to intact cells

    • Measure disappearance of phosphorylated lipids or appearance of dephosphorylated products

    In vivo measurements:

    • Inject [32P]LPA or [32P]S1P into circulation

    • Collect blood samples at various time points (1, 2, 3, 5, and 10 min)

    • Extract and analyze lipids to determine degradation kinetics

    Mass spectrometry-based approaches:

    • Liquid chromatography followed by mass spectrometry to measure absolute levels of PA, LPA, S1P and their dephosphorylated products

    • Can determine specific molecular species affected by LPP3 activity

    When comparing methodologies, radiolabeled assays offer high sensitivity but require special handling, while mass spectrometry provides detailed molecular information but requires specialized equipment .

Advanced Research Questions

  • How does LPP3 deficiency impact thymic egress and immune function?

    LPP3 plays a critical role in regulating T cell egress from the thymus by controlling S1P gradients. Research has revealed:

    Mechanism of action:
    LPP3 destroys thymic S1P, maintaining the S1P gradient between thymus (low) and blood/lymph (high) that directs lymphocyte egress . This gradient is essential for proper T cell trafficking.

    Experimental approaches and findings:

    • Conditional deletion of LPP3 in either epithelial cells or endothelial cells is sufficient to inhibit T cell egress

    • Despite the expression of five additional S1P-degrading enzymes in the thymus, they cannot compensate for LPP3 loss

    • Analysis shows LPP3 deficiency leads to accumulation of mature T cells in the thymus

    Physiological consequences:
    LPP3 deficiency results in disrupted S1P gradients, impaired T cell trafficking, and potentially compromised immune surveillance due to reduced naive T cells in circulation. These findings suggest S1P generation and destruction are tightly regulated, with LPP3 being essential to maintain the balance required for proper immune function .

  • What molecular mechanisms explain LPP3's role in transport carrier formation at the ER-Golgi interface?

    LPP3 plays a crucial role in membrane trafficking between the ER and Golgi by regulating transport carrier formation through several mechanisms:

    Localization and function:

    • LPP3 localizes in compartments from ER export sites to the Golgi complex

    • It generates diacylglycerol (DAG) by dephosphorylating phosphatidic acid (PA)

    • DAG is critical for membrane curvature induction and recruitment of fission proteins

    Experimental evidence from depletion studies:
    LPP3 depletion results in:

    • Reduced number of tubules generated from the ER-Golgi intermediate compartment and Golgi

    • Abnormally long Golgi-derived tubules compared to control cells

    • Impaired Rab6-dependent retrograde transport of Shiga toxin subunit B from Golgi to ER

    • High accumulation of Golgi-associated membrane buds

    • Decreased levels of de novo synthesized DAG and Golgi-associated DAG contents

    Mechanistic confirmation:
    Overexpression of a catalytically inactive form of LPP3 mimics the effects of LPP3 knockdown on Rab6-dependent retrograde transport, confirming that phosphatase activity is essential for this function .

    These findings demonstrate that LPP3 regulates membrane trafficking by modulating local lipid composition, particularly by generating DAG that facilitates membrane curvature and fission necessary for proper transport carrier formation.

  • How does LPP3 interact with integrins independently of its phosphatase activity?

    Beyond its phosphatase function, LPP3 plays a non-catalytic role in cell adhesion through integrin interactions:

    Structural basis:
    Human LPP3 contains an exposed arginine-glycine-aspartate (RGD) cell adhesion sequence on its second extracellular loop between transmembrane α-helices III and IV . This motif is known to mediate binding to integrins.

    Integrin binding properties:

    • LPP3 binds primarily to αvβ3 and α5β1 integrins

    • This interaction promotes cell-cell adhesion independently of catalytic LPP activity

    • Mutation of RGD to RGE in human LPP3 abolishes this interaction

    Species differences:
    Interestingly, mouse and rat LPP3 naturally contain RGE (arginine-glycine-glutamate) instead of RGD, yet murine LPP3 can still interact with α5β1 and αvβ3 integrins . In contrast, LPP1 possesses RGN (arginine-glycine-asparagine) and cannot bind to integrins .

    Functional significance:

    • Anti-LPP3 antibodies block basic fibroblast growth factor and vascular endothelial growth factor-induced capillary morphogenesis

    • This suggests a role for LPP3-integrin interactions in angiogenesis

    • The dual functionality (enzymatic and adhesive) allows LPP3 to coordinate lipid signaling with cell adhesion during development and tissue homeostasis

    This non-catalytic aspect of LPP3 function represents an important consideration when designing experiments to study its role in cellular processes.

  • What is the relationship between LPP3 and cardiovascular disease risk?

    LPP3 has been implicated in cardiovascular disease through multiple mechanisms:

    Genetic associations:
    The PPAP2B gene contains one of 27 loci associated with increased risk of coronary artery disease . Genetic variants that regulate LPP3 expression are established risk factors for atherosclerotic cardiovascular disease .

    Expression patterns:
    LPP3 is dynamically upregulated during vascular inflammation, with particularly heightened expression in smooth muscle cells (SMCs) . In response to athero-relevant flows, LPP3 can promote anti-inflammatory phenotypes in vascular cells .

    Experimental findings in disease models:
    Contrary to expectations, research has shown that:

    • Plpp3 global reduction (Plpp3+/-) or SMC-specific deletion protects hyperlipidemic mice from Angiotensin II-mediated aneurysm formation

    • LPP3 expression regulates SMC differentiation state, with lower LPP3 levels promoting a fibroblast-like phenotype

    • Decreased inactivation of bioactive LPA in settings of LPP3 deficiency may explain these protective effects

    • Deletion of LPA receptor 4 in mice promotes early aortic dilation and rupture in response to Angiotensin II

    Mechanistic insights:
    LPP3's role appears complex - while it generally protects against atherogenesis by degrading pro-inflammatory LPA, its effects on specific vascular pathologies like aneurysm formation may depend on the balance between different LPA receptor signaling pathways and SMC phenotypic modulation .

    These findings highlight the context-dependent role of LPP3 in cardiovascular disease and suggest potential therapeutic opportunities targeting LPA metabolism and signaling.

  • What are the challenges in developing specific inhibitors for LPP3?

    Developing specific inhibitors for LPP3 presents several technical challenges:

    Structural challenges:

    • LPP3 is a multi-pass transmembrane protein, making crystallization difficult

    • The crystal structure of LPP3 has not yet been solved, limiting structure-based drug design

    • The catalytic site faces the extracellular/luminal domain, requiring inhibitors to access this orientation

    Selectivity issues:

    FeatureChallenge for Inhibitor Development
    Conserved catalytic domainsC1, C2, and C3 domains are highly conserved among LPP family members
    Multiple substratesLPP3 processes various lipid phosphates, complicating selective targeting
    Redundant functionsPotential functional overlap with other phosphatases
    Multiple subcellular locationsPresent on plasma membrane, ER, and Golgi membranes

    Successful approaches:

    • Targeting unique regions outside the catalytic domains

    • Exploiting differences in the first extracellular loop, which may be involved in substrate recognition

    • Use of tetracyclines, which have been shown to increase LPP expression on plasma membranes

    • FTY720-P has shown specificity for LPP3 over other LPP family members

    Alternative strategies:
    For research purposes, genetic approaches like RNAi or CRISPR/Cas9 gene editing have proven more specific than pharmacological inhibition. Inducible expression systems also provide temporal control of LPP3 activity that may be preferable to inhibitors for certain experimental questions .

  • How do different genetic knockout models of LPP3 inform our understanding of its tissue-specific functions?

    Various genetic models have revealed distinct tissue-specific functions of LPP3:

    Complete knockout:

    • Embryonically lethal

    • Defects in chorio-allantoic placenta and yolk sac vasculature formation

    • Some embryos show shortening of anterior-posterior axis similar to Wnt signaling defects

    Conditional tissue-specific knockouts:

    Tissue-Specific DeletionPhenotypeResearch Implications
    Endothelial cells (Tie2-Cre)Embryonic lethality between E8.5-E10.5 and E11.5-E13.5, vascular leakage, hemorrhage, defective heart developmentEssential role in vascular development
    Epithelial or endothelial cellsImpaired T cell egress from thymusRole in immune cell trafficking via S1P gradient regulation
    Smooth muscle cells (SM22-Δ)Protection from Angiotensin II-mediated aortic aneurysm formation in hyperlipidemic miceContext-dependent role in vascular pathology
    Cerebellum-specificDisrupted S1P levels, impaired development and functionRole in neural development

    Hypomorphic models:
    Partial reduction of LPP3 (Plpp3+/-) shows protection from aneurysm formation but may have other subtle cardiovascular phenotypes .

    These diverse models reveal that LPP3 functions are highly tissue-specific and context-dependent. The enzyme plays critical roles in development, vascular biology, and immune function that cannot be fully compensated by other LPP family members. The varied and sometimes contradictory phenotypes suggest complex interactions between LPP3-regulated lipid signaling and other biological pathways.

  • How does LPP3 regulate the sphingosine-1-phosphate (S1P) gradient essential for lymphocyte trafficking?

    LPP3 plays a crucial role in establishing and maintaining S1P gradients required for lymphocyte trafficking:

    Biochemical mechanism:

    • LPP3 dephosphorylates S1P to sphingosine, which can be taken up by cells

    • This enzymatic action reduces extracellular S1P concentration in tissues like the thymus

    • The resulting gradient (high S1P in blood/lymph, low in lymphoid tissues) guides lymphocyte egress

    Experimental evidence:

    • In LPP3-deficient mice, T cells accumulate in the thymus despite the presence of five other S1P-degrading enzymes

    • LPP3 shows higher efficiency at S1P degradation than other LPP family members in vivo

    • Conditional deletion in either epithelial or endothelial cells is sufficient to disrupt the gradient

    Methodological approaches to study this process:

    • Mass spectrometry to measure S1P levels in different compartments

    • Flow cytometry to analyze T cell populations in thymus vs. circulation

    • Ex vivo assays measuring S1P degradation in tissue samples

    • Tracking cell migration using adoptive transfer experiments with labeled cells

    Additional regulatory mechanisms:

    • S1P concentrations in plasma range from 100 nM to 1 μM

    • Exogenous S1P is cleared from circulation in 15-30 minutes

    • While SPPs and SPL (located on ER) contribute to S1P metabolism, plasma membrane-localized LPPs have an essential role in regulating extracellular S1P

    • Sphingosine formed by LPP3 can be taken up by cells and rephosphorylated to S1P, creating a cycle of degradation and synthesis

    This critical function of LPP3 highlights its importance not just in lipid metabolism but in immune system regulation, with potential implications for inflammatory and autoimmune diseases.

  • How does the oligomeric state of LPP3 affect its function and regulation?

    Research has shown that the oligomeric state of LPP3 influences its activity, localization, and regulation:

    Oligomerization characteristics:

    • LPP3 can form both homo-oligomers (with itself) and hetero-oligomers (with other LPP family members)

    • Each subunit in these oligomeric structures functions independently in dephosphorylation reactions

    • Studies in Drosophila melanogaster show dimerization of Wunen (homolog of mammalian LPP3), although this is not required for its biological function

    Functional implications:

    • Different combinations of oligomeric states may regulate subcellular localization of LPP3

    • Oligomerization could affect substrate accessibility to the catalytic site

    • The orientation of LPP3 in membranes influences whether it acts on extracellular or luminal substrates

    • Some evidence suggests co-localization with other enzymes in membrane microdomains, such as LPP3 and PLD2 in caveolin-1-enriched domains

    Research approaches:

    • Co-immunoprecipitation to detect protein-protein interactions

    • Blue native PAGE to analyze native protein complexes

    • FRET or BRET to study protein associations in living cells

    • Cross-linking studies to stabilize transient interactions

    • Mutagenesis of potential interaction domains

    Regulatory significance: The ability of LPP3 to form different oligomeric states adds another layer of regulation to its function. This may allow for fine-tuning of lipid phosphate metabolism in different subcellular compartments and under various physiological conditions, potentially explaining some of the context-dependent effects observed in different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.