Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Lhfpl1; Lhfp; LHFPL tetraspan subfamily member 1 protein; Lipoma HMGIC fusion partner-like 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-220
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Lhfpl1
Target Protein Sequence
STSYFLPYWLFGSQLGKPVSFSTFRRCNYPVRGDGHNLIMVEECGRYASFAAIPSLAWQM CTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISSGCALYPLGWN SPEVMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVMLVENI MRNTNSYAMELDHCLKP
Uniprot No.

Target Background

Database Links
Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Rat Lhfpl1 and to which protein family does it belong?

Rat Lhfpl1 (Gene ID: 300286) is the rat ortholog of the lipoma HMGIC fusion partner-like 1 gene. It belongs to the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes . This family has gained significant research interest due to its involvement in various biological processes and pathological conditions. The LHFP protein family consists of at least four to five members with closely related structures and potential functions . Rat Lhfpl1 shares significant sequence homology with other mammalian orthologs, including human LHFPL1 (Gene ID: 340596) and mouse Lhfpl1 (Gene ID: 237091), suggesting evolutionary conservation of function across species .

What is known about the structural features of Lhfpl1 protein?

The Lhfpl1 protein is characterized by its tetraspan transmembrane architecture, featuring four transmembrane domains that anchor the protein within cellular membranes. Based on sequence analysis of the human ortholog, which shares high similarity with rat Lhfpl1, the protein consists of approximately 200 amino acids . The protein's topology includes both intracellular and extracellular domains connected by the transmembrane regions, creating a structure capable of participating in various cellular processes including signal transduction and protein-protein interactions. The high degree of evolutionary conservation of Lhfpl1 across multiple species (including human, mouse, rat, sheep, guinea pig, cow, dog, cat, and naked mole-rat) suggests critical functional importance . The tertiary structure remains to be fully characterized through crystallography or cryo-EM techniques.

What is the genetic organization and expression pattern of rat Lhfpl1?

The rat Lhfpl1 gene (Gene ID: 300286) shares organizational similarities with its human counterpart. In humans, Northern blot analysis has detected a transcript of approximately 2.4 kb in a variety of tissues, suggesting widespread expression . While rat-specific expression data is limited in the available literature, the gene likely exhibits a similar multi-tissue expression pattern based on the high conservation across species . The gene contains multiple exons that can undergo alternative splicing, though the biological validity of these splice variants has not been conclusively determined . Expression levels may vary across tissues and developmental stages, potentially correlating with tissue-specific functions. Researchers investigating rat Lhfpl1 should consider employing RT-PCR, RNA-seq, or Northern blotting to characterize expression patterns in their specific experimental contexts.

How can recombinant Rat Lhfpl1 protein be efficiently expressed and purified?

The expression and purification of recombinant Rat Lhfpl1 presents challenges typical of transmembrane proteins. A methodological approach would include:

The purification protocol should be optimized based on the specific experimental requirements and downstream applications.

What are the common experimental models for studying Lhfpl1 function?

Several experimental models can be employed to study Lhfpl1 function:

Model TypeAdvantagesLimitationsApplications
Cell Culture (rat primary cells or cell lines)Control over variables, easy genetic manipulation, cost-effectiveMay not recapitulate tissue contextProtein localization, trafficking, basic molecular interactions
Rat Knockout/Knockdown ModelsIn vivo physiological context, tissue-specific effectsTime-consuming, potentially complex phenotypesPhenotypic analysis, functional significance
Overexpression SystemsAmplifies effects for easier detectionPotential artifacts from non-physiological levelsDominant-negative effects, structure-function relationships
Yeast Two-HybridIdentifies protein interactionsHigh false-positive rateMapping protein interaction networks
CRISPR-Cas9 Edited ModelsPrecise genetic modificationOff-target effectsFunction of specific domains or residues

When designing experiments, researchers should consider combining multiple models to provide complementary insights and validate findings across different experimental systems .

How does the structure of Lhfpl1 relate to its function in cellular signaling pathways?

The tetraspan transmembrane structure of Lhfpl1 suggests potential roles in membrane organization, protein scaffolding, and signal transduction. While specific signaling pathways involving rat Lhfpl1 have not been fully characterized, research on related family members provides valuable insights. The transmembrane domains likely anchor the protein within specific membrane microdomains, potentially facilitating the formation of signaling complexes.

To investigate Lhfpl1's role in signaling:

  • Protein Interaction Studies: Employ co-immunoprecipitation, proximity labeling (BioID/APEX), or pull-down assays to identify interacting partners that may reveal associated signaling pathways.

  • Domain Mutation Analysis: Generate targeted mutations in specific domains to assess their contribution to signaling functions.

  • Phosphoproteomics: Compare phosphorylation patterns in control versus Lhfpl1-depleted cells to identify affected signaling cascades.

  • Subcellular Localization: Determine precise membrane localization (plasma membrane, endoplasmic reticulum, vesicles) as this may correlate with specific signaling functions.

While direct evidence linking Lhfpl1 to specific pathways is limited, its structural similarity to other tetraspan proteins suggests potential involvement in receptor trafficking, ion channel modulation, or cell adhesion signaling .

What experimental approaches can be used to investigate the potential role of rat Lhfpl1 in lipoma formation or other pathological conditions?

The association of LHFP family members with lipomas, particularly through HMGIC fusion events, suggests potential roles for Lhfpl1 in pathogenesis. To investigate these roles:

  • Expression Analysis in Pathological Samples:

    • Compare Lhfpl1 expression levels between normal adipose tissue and lipomas using qRT-PCR or RNA-seq

    • Perform immunohistochemistry to assess protein localization and expression patterns

  • Fusion Transcript Detection:

    • Design PCR primers spanning potential fusion breakpoints

    • Employ FISH (Fluorescence In Situ Hybridization) to detect chromosomal rearrangements

    • Validate using RNA-seq with fusion-detection algorithms

  • Functional Studies:

    • Generate cell models expressing wild-type Lhfpl1 or potential fusion constructs

    • Assess effects on cell proliferation, migration, and adipocyte differentiation

    • Analyze changes in gene expression profiles using microarray or RNA-seq

  • In Vivo Models:

    • Develop transgenic rat models expressing Lhfpl1-fusion constructs

    • Monitor for spontaneous development of lipomas or other abnormalities

    • Analyze tissue-specific effects using Cre-loxP conditional expression systems

A comprehensive experimental design would include appropriate controls and multiple methodological approaches to establish causal relationships between Lhfpl1 dysfunction and pathological outcomes .

How can researchers distinguish between the functions of Lhfpl1 and other members of the LHFP protein family?

Distinguishing between functions of Lhfpl1 and related family members requires targeted experimental approaches:

  • Sequence and Structure Comparison:

    • Conduct detailed bioinformatic analysis of sequence conservation and divergence

    • Identify unique domains or motifs specific to Lhfpl1

    • Model structural differences that might confer functional specificity

  • Paralog-Specific Knockdown/Knockout:

    • Design highly specific siRNA or shRNA constructs targeting unique regions

    • Develop CRISPR-Cas9 knockout models for each family member

    • Perform rescue experiments with individual family members to test functional redundancy

  • Expression Pattern Analysis:

    • Compare tissue-specific and developmental expression patterns

    • Identify contexts where Lhfpl1 is expressed without other family members

  • Interaction Profiling:

    • Conduct comparative interactome analysis using mass spectrometry

    • Identify protein partners unique to Lhfpl1 versus shared with other family members

  • Phenotypic Analysis:

    • Compare phenotypes resulting from manipulation of different family members

    • Look for distinct versus overlapping cellular effects

This multifaceted approach can help delineate specific functions of Lhfpl1 while accounting for potential functional redundancy within the LHFP family .

What are the challenges in studying protein-protein interactions involving transmembrane proteins like Lhfpl1?

Studying protein-protein interactions involving transmembrane proteins like Lhfpl1 presents several unique challenges:

  • Membrane Environment Preservation:

    • Traditional interaction assays may disrupt native membrane environments

    • Detergent selection is critical but can alter interaction dynamics

    • Solution: Use mild detergents (DDM, CHAPS) or native nanodiscs/liposomes for reconstitution

  • Low Expression Levels:

    • Transmembrane proteins often express poorly in heterologous systems

    • Solution: Optimize expression conditions with screening approaches or use endogenous tagging

  • Hydrophobicity and Solubility Issues:

    • Hydrophobic domains complicate purification and interaction studies

    • Solution: Consider membrane-specific interaction techniques (MYTH, split-ubiquitin systems)

  • Orientation-Dependent Interactions:

    • Proper topology is essential for physiologically relevant interactions

    • Solution: Validate interactions using in situ approaches (FRET, BiFC, PLA)

  • Dynamic and Transient Interactions:

    • Many transmembrane protein interactions are dynamic or stimulus-dependent

    • Solution: Use crosslinking approaches or interaction capture under specific conditions

A systematic experimental design would incorporate multiple complementary techniques to overcome these challenges, potentially including:

TechniqueAdvantagesLimitationsApplication for Lhfpl1
Cross-linking Mass Spectrometry (XL-MS)Captures interactions in native environmentComplex data analysisIdentifying proximal proteins in membrane complexes
Proximity Labeling (BioID/APEX)Identifies nearby proteins without direct interactionBackground labelingMapping Lhfpl1 neighborhood in membrane
Co-immunoprecipitation with optimized detergentsDirect interaction evidenceDetergent may disrupt some interactionsValidating specific interaction partners
Membrane Yeast Two-Hybrid (MYTH)Specifically designed for membrane proteinsLimited to binary interactionsScreening potential interactors
In situ Proximity Ligation Assay (PLA)Visualizes interactions in native cellular contextAntibody-dependentConfirming interactions in tissue samples

These methodological considerations are crucial for generating reliable data on Lhfpl1 interactions .

How might post-translational modifications affect Lhfpl1 function and how can these be studied?

Post-translational modifications (PTMs) likely play critical roles in regulating Lhfpl1 function, localization, and interactions. While specific PTMs of rat Lhfpl1 are not well-characterized in the available literature, common modifications of transmembrane proteins include phosphorylation, glycosylation, palmitoylation, and ubiquitination.

Methodological approaches to study Lhfpl1 PTMs include:

  • Identification of PTM Sites:

    • Mass spectrometry-based proteomics using enrichment techniques for specific modifications

    • Site-directed mutagenesis of predicted modification sites followed by functional analysis

    • Targeted western blotting with modification-specific antibodies

  • Functional Impact Assessment:

    • Generate non-modifiable mutants (e.g., S/T→A for phosphorylation sites)

    • Compare cellular localization, trafficking, and protein interactions between wild-type and mutant proteins

    • Assess effects on downstream signaling pathways

  • Regulation of Modifications:

    • Determine stimuli that induce or remove specific modifications

    • Identify the enzymes (kinases, glycosyltransferases, etc.) responsible for the modifications

    • Use inhibitors or genetic approaches to modulate these enzymes

  • Temporal Dynamics:

    • Monitor modification changes during cellular processes using time-course experiments

    • Correlate modifications with functional outcomes

  • Structural Consequences:

    • Employ structural biology techniques to determine how modifications alter protein conformation

    • Use molecular dynamics simulations to predict effects of modifications

This systematic approach would provide insights into how PTMs regulate Lhfpl1 function in various cellular contexts and potential dysregulation in pathological conditions .

What experimental design principles should be applied when studying Lhfpl1 function?

When designing experiments to investigate Lhfpl1 function, researchers should adhere to rigorous experimental design principles:

  • Variable Identification and Control:

    • Clearly define independent variables (e.g., Lhfpl1 expression levels, mutations, treatments)

    • Precisely measure dependent variables (e.g., phenotypic changes, signaling responses)

    • Identify and control potential confounding variables (e.g., cell density, passage number)

  • Hypothesis Formulation:

    • Develop specific, testable hypotheses about Lhfpl1 function

    • Example null hypothesis: "Lhfpl1 knockdown does not affect cellular lipid metabolism"

    • Example alternative hypothesis: "Lhfpl1 knockdown leads to altered lipid droplet formation"

  • Treatment Design:

    • Include appropriate controls (positive, negative, and vehicle controls)

    • Consider dose-response relationships when manipulating Lhfpl1 expression

    • Determine treatment duration based on the expected timescale of responses

  • Subject Assignment:

    • Use randomization to assign experimental units to treatment groups

    • Consider statistical power in determining sample sizes

    • Choose between between-subjects or within-subjects designs based on experimental constraints

  • Measurement Planning:

    • Develop precise, reliable protocols for measuring outcomes

    • Use multiple complementary techniques to validate findings

    • Include appropriate statistical analyses to interpret results

By systematically addressing these design considerations, researchers can generate more robust and reproducible data on Lhfpl1 function.

What are the optimal approaches for generating Lhfpl1 knockdown or knockout models?

Creating effective Lhfpl1 knockdown or knockout models requires careful consideration of various methodological approaches:

  • Transient Knockdown Strategies:

    • siRNA or shRNA targeting: Design multiple siRNAs targeting different regions of Lhfpl1 mRNA

    • Antisense oligonucleotides: Consider morpholinos for developmental studies

    • Advantages: Rapid implementation, titration of knockdown levels

    • Limitations: Incomplete knockdown, off-target effects, temporary nature

  • Stable Knockout Technologies:

    • CRISPR-Cas9: Design guide RNAs targeting early exons with low off-target potential

    • TALENs or ZFNs: Alternative options if CRISPR efficiency is problematic

    • Homologous recombination: Traditional approach for precise modifications

    • Advantages: Complete gene ablation, stable inheritance

    • Limitations: Potential compensatory mechanisms, developmental lethality

  • Conditional Approaches:

    • Cre-loxP systems: Allow tissue-specific or inducible knockouts

    • Tet-on/off systems: Enable temporal control of expression

    • Advantages: Spatial and temporal specificity, avoids developmental complications

    • Limitations: Leakiness, complex breeding schemes for in vivo models

  • Validation Strategies:

    • Verify knockdown/knockout at DNA level (PCR, sequencing)

    • Confirm reduced mRNA expression (qRT-PCR, RNA-seq)

    • Validate protein absence (Western blot, immunofluorescence)

    • Assess restoration of phenotype with rescue constructs

Each approach has specific applications depending on the research question, model system, and required level of gene modulation. The choice should be guided by the specific experimental objectives and system constraints .

How can researchers overcome challenges in detecting and quantifying Lhfpl1 expression?

Detecting and quantifying Lhfpl1 expression presents several challenges due to potential low abundance, membrane localization, and antibody specificity issues. A comprehensive methodological approach includes:

  • mRNA Detection Strategies:

    • qRT-PCR: Design primers spanning exon junctions to avoid genomic DNA amplification

    • RNA-seq: Provides comprehensive expression data and splicing information

    • In situ hybridization: Localizes mRNA expression in tissue contexts

    • Digital droplet PCR: Offers absolute quantification for low-abundance transcripts

    • Normalization: Use multiple reference genes validated for stability in the experimental system

  • Protein Detection Approaches:

    • Antibody validation: Rigorously validate antibodies using knockout/knockdown controls

    • Epitope tagging: Consider adding detection tags when antibodies are limiting

    • Western blotting optimization: Use appropriate membrane extraction protocols

    • Immunoprecipitation: Enrich for low-abundance protein before detection

    • Mass spectrometry: Consider targeted approaches like SRM/MRM for quantification

  • Subcellular Localization:

    • Immunofluorescence: Optimize fixation and permeabilization for membrane proteins

    • Subcellular fractionation: Separate membrane compartments before detection

    • Electron microscopy: For ultra-structural localization studies

  • Quantification Methods:

    • Standard curves for absolute quantification

    • Relative quantification with appropriate normalizers

    • Digital image analysis for consistent quantification of microscopy data

By combining multiple technical approaches and including appropriate controls, researchers can overcome the challenges associated with reliable Lhfpl1 detection and quantification.

What are the best practices for analyzing data from Lhfpl1 experiments to ensure reproducibility?

Ensuring reproducibility in Lhfpl1 research requires rigorous data analysis practices:

  • Pre-analysis Planning:

    • Develop a statistical analysis plan before conducting experiments

    • Determine sample sizes using power analysis

    • Pre-register experiments when possible to reduce publication bias

    • Establish inclusion/exclusion criteria a priori

  • Data Processing:

    • Use standardized processing workflows

    • Document all data transformations and normalizations

    • Retain raw data alongside processed data

    • Use appropriate controls for normalization

  • Statistical Analysis:

    • Choose appropriate statistical tests based on data distribution and experimental design

    • Correct for multiple comparisons when appropriate

    • Report effect sizes and confidence intervals, not just p-values

    • Consider using non-parametric tests when assumptions of normality are violated

  • Result Validation:

    • Replicate key findings with independent experimental approaches

    • Use both biological and technical replicates

    • Consider independent validation by different researchers or laboratories

    • Test robustness by varying experimental conditions

  • Reporting Standards:

    • Follow field-specific reporting guidelines

    • Share detailed protocols, including exact reagent information

    • Consider depositing raw data in appropriate repositories

    • Document software versions and parameters used for analysis

By adhering to these best practices, researchers can enhance the reliability and reproducibility of findings related to Lhfpl1 function and expression .

How should researchers approach the integration of Lhfpl1 functional data with broader genomic and proteomic datasets?

Integrating Lhfpl1 functional data with broader -omics datasets requires systematic methodological approaches:

  • Multi-omics Data Collection:

    • Generate or obtain complementary datasets (transcriptomics, proteomics, metabolomics)

    • Ensure comparable experimental conditions across platforms

    • Include appropriate time points to capture dynamic responses

  • Data Processing and Normalization:

    • Apply platform-specific normalization techniques

    • Account for batch effects using appropriate statistical methods

    • Consider data imputation strategies for missing values

    • Transform data to comparable scales when necessary

  • Integration Strategies:

    • Correlation-based approaches: Identify relationships between Lhfpl1 expression and other molecules

    • Network analysis: Position Lhfpl1 within protein-protein or gene regulatory networks

    • Pathway enrichment: Identify biological processes associated with Lhfpl1 function

    • Machine learning: Develop predictive models incorporating multi-omics data

  • Biological Interpretation:

    • Contextualize findings within known biological pathways

    • Identify potential new functional associations for Lhfpl1

    • Generate testable hypotheses for further experimental validation

    • Consider evolutionary conservation of identified relationships

  • Visualization Approaches:

    • Develop integrative visualizations that capture multi-dimensional relationships

    • Use dimensionality reduction techniques (PCA, t-SNE, UMAP) to identify patterns

    • Create interactive visualization tools when appropriate

This integrative approach can reveal Lhfpl1 functions that might not be apparent from single-omics analyses and place the protein within broader biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.