Recombinant Rat Lipoma HMGIC fusion partner-like protein 4 (Lhfpl4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please include your request in the order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Lhfpl4; LHFPL tetraspan subfamily member 4 protein; Lipoma HMGIC fusion partner-like 4 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Lhfpl4
Target Protein Sequence
MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFG LFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFALFFFCN TATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILA IIGILNALILSFLAFVLGNRQTDLLQEELKQENKDFVGTTVSSVLRPGGDVSGWGVLPCP VAHTQGP
Uniprot No.

Target Background

Function
LHFPL4 plays a crucial role in regulating inhibitory synapse formation and function. It is involved in maintaining the clustering of gamma-aminobutyric acid receptors (GABAARs) and their associated scaffold proteins at inhibitory synaptic sites. LHFPL4 functions in conjunction with NLGN2 to recruit or stabilize GABAARs.
Gene References Into Functions
  1. This research establishes LHFPL4 as a synapse-specific tetraspanin crucial for inhibitory synapse function, providing valuable insights into the molecular composition of inhibitory synapses. PMID: 28978485
Database Links
Protein Families
LHFP family
Subcellular Location
Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoma HMGIC Fusion Partner-Like Protein 4 (Lhfpl4)?

Lhfpl4 is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which belongs to the superfamily of tetraspan transmembrane protein encoding genes. This protein family is named after LHFP, a gene first identified as a translocation partner of HMGIC in a lipoma with t(12;13) chromosomal rearrangement . In rats, the full-length Lhfpl4 protein consists of 247 amino acids and contains multiple transmembrane domains characteristic of tetraspan proteins . Lhfpl4 is conserved across multiple species, suggesting evolutionary importance of its biological functions . Research has shown that Lhfpl4 is specifically enriched at inhibitory postsynaptic domains in neurons, where it colocalizes with gephyrin opposite vesicular GABA transporter (VGAT)-labeled inhibitory presynaptic terminals .

How conserved is Lhfpl4 across different species?

Lhfpl4 shows remarkable evolutionary conservation across vertebrate species, suggesting fundamental biological importance. The protein has been identified in numerous species including:

SpeciesGene IDUniProt IDNotable Features
Human375323Q7Z7J7Member of tetraspan transmembrane protein family
Mouse269788A6NH76Similar structure to rat ortholog
Rat353230Q7TSY2247 amino acids, multiple transmembrane domains
Naked mole-rat101723996-Conserved structural features
Cow540541-Conservation suggests functional importance
Sheep101105445-Similar to other mammalian orthologs
Chicken770959-Conservation extends to avian species
Dog484669-Similar to other mammalian orthologs
Domestic cat101090595-Similar to other mammalian orthologs
Domestic guinea pig100720214Q29RV7Similar to other mammalian orthologs

This high level of conservation across diverse vertebrates suggests that Lhfpl4 likely serves similar critical functions throughout evolution, particularly in neuronal systems .

What expression systems are effective for producing recombinant Rat Lhfpl4?

Escherichia coli (E. coli) has been demonstrated as an effective expression system for producing recombinant rat Lhfpl4 protein. When expressed in this system, the protein can be fused with an N-terminal His tag to facilitate purification through affinity chromatography . This approach yields protein with greater than 90% purity as determined by SDS-PAGE. The recombinant protein typically contains the full-length sequence (amino acids 1-247) and can be produced in sufficient quantities for various research applications .

Key considerations when choosing an expression system include:

  • Protein folding requirements: Tetraspan proteins like Lhfpl4 contain multiple transmembrane domains that may require specialized conditions for proper folding.

  • Post-translational modifications: If studying interactions that depend on glycosylation or phosphorylation, mammalian or insect cell systems might be preferable.

  • Experimental application: The intended use (structural studies, binding assays, etc.) should inform the choice of expression system.

What are the optimal methods for reconstituting and storing recombinant Rat Lhfpl4?

For optimal handling of lyophilized recombinant Rat Lhfpl4 protein, follow these methodological guidelines:

  • Initial handling: Briefly centrifuge the vial prior to opening to bring contents to the bottom.

  • Reconstitution: Dissolve the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Long-term storage preparation: Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation).

  • Storage: Prepare single-use aliquots and store at -20°C/-80°C.

  • Usage recommendations: Avoid repeated freeze-thaw cycles, which can lead to protein degradation. Working aliquots can be stored at 4°C for up to one week .

The reconstituted protein is typically stored in a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose, which helps maintain protein stability during the freeze-drying and reconstitution process .

How can researchers verify Lhfpl4 expression and subcellular localization in neuronal tissues?

Multiple complementary techniques can be employed to verify the expression and subcellular localization of Lhfpl4 in neuronal tissues:

TechniqueApplicationAdvantagesLimitations
Western blottingProtein expression level and molecular weight verificationQuantitative, detects specific isoforms (27 kDa and 17 kDa bands)Limited spatial information
ImmunohistochemistryTissue-level distributionPreserves anatomical contextLower resolution than fluorescence methods
Immunofluorescence with confocal microscopyCellular and subcellular localizationCo-localization with synaptic markers (gephyrin, VGAT)Diffraction-limited resolution
Structured illumination microscopy (SIM)Nanoscale organizationReveals Lhfpl4 nano-clusters overlaying gephyrin punctaTechnically demanding
Recombinant expression (GFP-tagged)Dynamic traffickingLive imaging possibleTag may affect protein function

When using fluorescence microscopy, Lhfpl4 forms discrete membrane clusters on neuronal soma and dendrites that robustly colocalize with the inhibitory postsynaptic marker gephyrin opposite VGAT-labeled inhibitory presynaptic terminals. Quantitative analysis has shown that Lhfpl4 is approximately 6-fold more enriched at inhibitory compared to excitatory synapses .

What is the role of Lhfpl4 at inhibitory synapses?

Lhfpl4 plays a critical role in organizing inhibitory postsynaptic domains in neurons. Research using both overexpressed GFP-tagged LHFPL4 and antibodies against endogenous LHFPL4 has demonstrated that this protein is selectively enriched at inhibitory synapses, where it colocalizes with gephyrin . Line scan analysis through LHFPL4-GFP clusters shows peak fluorescence essentially overlapping with gephyrin and adjacent to VGAT fluorescence, confirming its postsynaptic localization .

At the molecular level, Lhfpl4 appears to be essential for proper clustering of GABA-A receptors and gephyrin at inhibitory synapses. Super-resolution microscopy techniques (SIM) have revealed that LHFPL4 forms groups of nano-clusters that overlay gephyrin puncta, suggesting a role in the nanoscale organization of inhibitory postsynaptic domains . The intimate association between Lhfpl4 and GABA-A receptors indicates that this tetraspan protein may serve as a molecular bridge or anchor that helps stabilize receptor complexes at the synapse.

What phenotypic changes are observed in Lhfpl4 knockout models?

Studies of LHFPL4 knockout (Lhfpl4−/−) mice have revealed significant cellular and molecular changes without obvious behavioral abnormalities. These animals remain viable into adulthood, are fertile, and show no obvious behavioral differences from wild-type animals .

At the cellular level, neurons from Lhfpl4−/− mice exhibit:

  • Dramatic loss of gephyrin clustering

  • Marked reduction in GABA-A receptor-γ2 clustering

  • Significant decrease in VGAT-positive clusters co-labeled for gephyrin

  • Unaltered clustering of VGAT alone (presynaptic marker)

  • Unaltered clustering of homer (excitatory synapse marker)

These findings indicate that Lhfpl4 has a selective role in organizing inhibitory postsynaptic domains rather than affecting synapse formation more generally. The preservation of inhibitory presynaptic terminals (VGAT-positive clusters) and excitatory synapses in knockout animals suggests that Lhfpl4's function is specific to the postsynaptic side of inhibitory synapses .

Does Lhfpl4 exhibit synaptogenic properties?

Unlike some inhibitory postsynaptic transmembrane molecules (such as neuroligin2), LHFPL4 does not appear to possess synaptogenic properties. When COS-7 cells overexpressing potential synaptogenic proteins were co-cultured with dissociated wild-type rat hippocampal neurons, LHFPL4 did not induce the formation of hemi-synapses by aggregating presynaptic proteins at the point of contact between the two cell types .

In contrast, neuroligin2 (a known synaptogenic protein) induced the formation of both inhibitory and excitatory hemi-synapses in the same experimental paradigm . This suggests that Lhfpl4 functions primarily in organizing existing synapses rather than inducing new synapse formation. Its role appears to be in stabilizing and clustering components of the inhibitory postsynaptic apparatus (GABA-A receptors and gephyrin) rather than initiating synaptogenesis through trans-synaptic interactions.

How can Lhfpl4 research contribute to understanding GABAergic dysfunction in neurological disorders?

Given its critical role in organizing inhibitory postsynaptic domains and GABA-A receptor clustering, Lhfpl4 represents a valuable research target for investigating neurological disorders associated with GABAergic dysfunction. Several research approaches can be employed:

  • Genetic analysis: Screening for LHFPL4 mutations or expression changes in patient samples from epilepsy, anxiety disorders, or neurodevelopmental conditions that involve inhibitory circuit dysfunction.

  • Animal models: Utilizing Lhfpl4 knockout or conditional knockout models to understand how disruptions in inhibitory synapse organization contribute to circuit hyperexcitability and dysfunction.

  • Electrophysiological assessment: Comparing inhibitory postsynaptic currents (IPSCs) between wild-type and Lhfpl4-deficient neurons to quantify functional deficits in GABAergic transmission.

  • Pharmacological rescue experiments: Testing whether enhancers of GABAergic transmission can compensate for Lhfpl4 deficiency.

  • Circuit-specific manipulations: Investigating the impact of Lhfpl4 deletion in specific neuronal populations to understand region-specific contributions to network dysfunction.

These approaches could reveal novel molecular mechanisms underlying GABAergic synapse dysfunction and potentially identify new therapeutic targets for conditions characterized by excitation/inhibition imbalance .

How might post-translational modifications affect Lhfpl4 function?

While specific information about post-translational modifications of Lhfpl4 is limited in the current literature, this tetraspan protein likely undergoes modifications that regulate its trafficking, stability, or interactions with other synaptic proteins. Potential modifications to investigate include:

  • Phosphorylation: Many synaptic proteins are regulated by phosphorylation in activity-dependent ways. Identification of potential phosphorylation sites on Lhfpl4 and their functional consequences could reveal regulatory mechanisms.

  • Palmitoylation: Tetraspan proteins often undergo palmitoylation, which can affect their membrane association and trafficking. Determining whether Lhfpl4 undergoes palmitoylation and how this affects its synaptic localization could provide important insights.

  • Ubiquitination: This modification often regulates protein turnover and endocytic trafficking. Investigating whether Lhfpl4 is subject to ubiquitination could reveal mechanisms controlling its synaptic abundance.

  • Glycosylation: As a transmembrane protein, Lhfpl4 might undergo glycosylation that could affect its stability or interactions.

Advanced proteomic approaches combined with site-directed mutagenesis could help identify and characterize these modifications and their functional consequences. Time-course studies examining how these modifications change during development or in response to neuronal activity might provide insights into the dynamic regulation of inhibitory synapse strength and plasticity.

What are the implications of the HMGIC fusion relationship for understanding Lhfpl4 function?

The Lhfpl4 gene belongs to a family named after LHFP (lipoma HMGIC fusion partner), which was first identified as a translocation partner of HMGIC in a lipoma with t(12;13) . This historical connection raises interesting questions about potential functional relationships between Lhfpl4 and chromosomal rearrangements or gene fusions.

In the original lipoma study, the LHFP gene was mapped to the long arm of chromosome 13, a region recurrently targeted by chromosomal aberrations in lipomas . The expressed HMGIC/LHFP fusion transcript encoded the three DNA binding domains of HMGIC followed by 69 amino acids encoded by frame-shifted LHFP sequences .

While the primary focus of current Lhfpl4 research is its role in neuronal function, particularly at inhibitory synapses, investigating whether Lhfpl4 can participate in similar fusion events or is subject to chromosomal rearrangements in pathological conditions could provide new insights. Additionally, comparing the functional domains of Lhfpl4 with those of other LHFP family members might reveal shared mechanisms or evolutionary adaptations that contribute to their diverse biological roles.

What are common challenges in working with recombinant Lhfpl4 and how can they be overcome?

Working with membrane proteins like Lhfpl4 presents several technical challenges:

ChallengeCauseSolution
Poor solubilityHydrophobic transmembrane domainsUse appropriate detergents; consider fusion tags that enhance solubility
Protein aggregationImproper folding or exposure of hydrophobic regionsOptimize buffer conditions; consider adding stabilizing agents like glycerol or trehalose
Low expression yieldsToxicity to expression host; protein instabilityTest different expression systems; optimize codon usage; use lower induction temperatures
Degradation during storageProtease contamination; freeze-thaw damageAdd protease inhibitors; prepare single-use aliquots; maintain consistent storage conditions
Loss of native conformationDenaturation during purificationUse milder purification conditions; validate protein structure with functional assays

For recombinant Rat Lhfpl4 specifically, proper reconstitution from lyophilized powder is critical. Follow manufacturer recommendations for buffer composition and avoid repeated freeze-thaw cycles by preparing single-use aliquots . Additionally, verifying protein integrity by SDS-PAGE before experimental use can help ensure consistent results.

How can researchers differentiate between direct and indirect effects when studying Lhfpl4 function?

To differentiate between direct and indirect effects when studying Lhfpl4 function, researchers should employ multiple complementary approaches:

  • Temporal manipulation: Use acute knockdown or conditional knockout systems to distinguish immediate effects from long-term compensatory changes.

  • Structure-function analysis: Generate point mutations or domain deletions to identify specific regions required for particular functions.

  • Biochemical interaction studies: Perform co-immunoprecipitation, proximity labeling, or yeast two-hybrid assays to identify direct binding partners.

  • Rescue experiments: Reintroduce wild-type or mutant forms of Lhfpl4 into knockout cells to determine which functions can be directly restored.

  • Cross-species comparisons: Compare results across different model systems to identify conserved direct functions versus species-specific or context-dependent effects.

  • Quantitative time-course studies: Monitor the temporal sequence of changes following Lhfpl4 manipulation to distinguish primary from secondary effects.

Using these approaches in combination can help build a comprehensive understanding of Lhfpl4's direct functional roles versus downstream consequences of its disruption.

What controls should be included when investigating Lhfpl4 clustering at inhibitory synapses?

When investigating Lhfpl4 clustering at inhibitory synapses, several critical controls should be included:

  • Antibody specificity validation:

    • Test antibodies on Lhfpl4 knockout tissue or cells

    • Include peptide competition controls

    • Compare multiple antibodies targeting different epitopes if available

  • Marker combinations for synaptic identification:

    • Include both inhibitory (gephyrin, GABA-A receptor subunits) and excitatory (homer, PSD-95) postsynaptic markers

    • Use presynaptic markers (VGAT for inhibitory, VGLUT for excitatory) to confirm synaptic localization

    • Quantify co-localization coefficients with appropriate statistical tests

  • When using tagged versions of Lhfpl4:

    • Compare localization patterns of tagged protein with endogenous protein

    • Test multiple tag positions (N-terminal vs. C-terminal) to ensure minimal interference

    • Include untagged controls in functional assays

  • Quantitative analysis considerations:

    • Measure cluster density, size, and intensity

    • Analyze distance relationships between pre- and postsynaptic markers

    • Use appropriate statistical methods for comparing distributions

    • Include randomization controls for co-localization analysis

Such rigorous controls ensure that observations about Lhfpl4 localization and function reflect genuine biological phenomena rather than technical artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.